GCA_000878265.1 - 12 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JXBC01000002.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	terpene	221,644	242,447
Region 2.2	NRPS-like,betalactone,NRPS	934,156	984,564	fengycin	NRP	100%

JXBC01000003.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	terpene	60,180	81,100
Region 3.2	T3PKS	129,854	170,318

JXBC01000004.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	lanthipeptide-class-ii,cyclic-lactone-autoinducer	279,781	304,970	kijanimicin	Polyketide	4%
Region 4.2	NRPS	510,903	576,294	surfactin	NRP:Lipopeptide	78%
Region 4.3	RiPP-like	582,816	593,202
Region 4.4	NRPS-like	697,076	740,483	rhizocticin A	Other	16%

JXBC01000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	lanthipeptide-class-ii	66,427	89,615	mersacidin	RiPP:Lanthipeptide	100%

JXBC01000013.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	NRPS	80,037	127,173	bacillibactin	NRP	100%
Region 13.2	lanthipeptide-class-i	314,751	340,716	subtilin	RiPP:Lanthipeptide	92%
Region 13.3	sactipeptide	698,899	720,504	subtilosin A	RiPP:Thiopeptide	75%

Region	Type	From	To	Most similar known cluster	Similarity
Region 2.1	terpene	221,644	242,447
Region 2.2	NRPS-like,betalactone,NRPS	934,156	984,564	fengycin	NRP	100%
Region 3.1	terpene	60,180	81,100
Region 3.2	T3PKS	129,854	170,318
Region 4.1	lanthipeptide-class-ii,cyclic-lactone-autoinducer	279,781	304,970	kijanimicin	Polyketide	4%
Region 4.2	NRPS	510,903	576,294	surfactin	NRP:Lipopeptide	78%
Region 4.3	RiPP-like	582,816	593,202
Region 4.4	NRPS-like	697,076	740,483	rhizocticin A	Other	16%
Region 6.1	lanthipeptide-class-ii	66,427	89,615	mersacidin	RiPP:Lanthipeptide	100%
Region 13.1	NRPS	80,037	127,173	bacillibactin	NRP	100%
Region 13.2	lanthipeptide-class-i	314,751	340,716	subtilin	RiPP:Lanthipeptide	92%
Region 13.3	sactipeptide	698,899	720,504	subtilosin A	RiPP:Thiopeptide	75%

Compact view

JXBC01000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 221,644 - 242,447 nt. (total: 20,804 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JXBC01000002.1 - Region 2 - NRPS,NRPS-like,betalactone

Download region GenBank file

Download region SVG

Location: 934,156 - 984,564 nt. (total: 50,409 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 934155 - 984564:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 934155 - 975777:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 937480 - 984564:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_1008

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg2_1012

Search NORINE for peptide: strict or relaxed

AMP-binding (180..573): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg2_1014

Search NORINE for peptide: strict or relaxed

AMP-binding (98..492): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg2_1016

Search NORINE for peptide: strict or relaxed

AMP-binding (261..662): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

JXBC01000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 60,180 - 81,100 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JXBC01000003.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 129,854 - 170,318 nt. (total: 40,465 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JXBC01000004.1 - Region 1 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 279,781 - 304,970 nt. (total: 25,190 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_290 - Putative Class II

ctg4_291 leader / core peptide: MSNREKAELYRNASKRTELGFVNPVGEVSEDELRNLAGA - ADVDhbPHDhbDhbPDhaDhaLPCGVFVDhbAAFCPDhaDhbKCDhbDhaDhaC
allorf_297835_298032 leader / core peptide: MYSFVKWVSFIYSYCNIIGTGVKKLTEKGA - EKNDVDhaVKNFLDhaYHLKLEGRFFIIRIVLALFDhaAEC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg4_291 - Class II

Cleavage pHMM score: 3.80

RODEO score: 0

Monoisotopic mass: 3016.4 Da

Molecular weight: 3018.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3036.4 Da N = 1; 3054.5 Da N = 2; 3072.5 Da N = 3; 3090.5 Da N = 4; 3108.5 Da N = 5; 3126.5 Da N = 6; 3144.6 Da N = 7

allorf_297835_298032 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 4044.2 Da

Molecular weight: 4046.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4064.7 Da N = 1; 4082.8 Da N = 2

JXBC01000004.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 510,903 - 576,294 nt. (total: 65,392 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 510902 - 576294:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_567

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg4_568

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2546..2934): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg4_569

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

JXBC01000004.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 582,816 - 593,202 nt. (total: 10,387 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JXBC01000004.1 - Region 4 - NRPS-like

Download region GenBank file

Download region SVG

Location: 697,076 - 740,483 nt. (total: 43,408 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 6, location 697075 - 740483:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_735

Search NORINE for peptide: strict or relaxed

AMP-binding (116..512): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

JXBC01000006.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 66,427 - 89,615 nt. (total: 23,189 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg6_92 - Putative Class II

ctg6_88 leader / core peptide: MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGA - GDMEAACDhbFDhbLPGGGGVCDhbLDhbDhaECIC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg6_88 - Class II

Cleavage pHMM score: -2.00

RODEO score: 0

Monoisotopic mass: 2399.0 Da

Molecular weight: 2400.8 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2418.8 Da N = 1

JXBC01000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 80,037 - 127,173 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 80036 - 127173:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_106

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg13_108

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

JXBC01000013.1 - Region 2 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 314,751 - 340,716 nt. (total: 25,966 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg13_359 - Putative Class I

allorf_324552_324671 leader / core peptide: LDVVKVSKQDSKITPQ - WKDhaEDhaLCDhbPGCVDhbGVCKLADhaFKQ

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

allorf_324552_324671 - Class I

Cleavage pHMM score: 15.10

RODEO score: 18

Monoisotopic mass: 2381.2 Da

Molecular weight: 2382.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2400.8 Da N = 1; 2418.8 Da N = 2

JXBC01000013.1 - Region 3 - sactipeptide

Download region GenBank file

Download region SVG

Location: 698,899 - 720,504 nt. (total: 21,606 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg13_765 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg13_765: Putative sactipeptide; RODEO score: 31.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG