GCA_000947115.1 - 50 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JZDI01000001.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	transAT-PKS	113,824	201,642	macrolactin H	Polyketide	100%
Region 1.2	transAT-PKS,T3PKS,NRPS	420,671	523,311	bacillaene	Polyketide + NRP	100%

JZDI01000010.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	terpene	66,857	87,597

JZDI01000106.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	terpene	1	8,022

JZDI01000118.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS-like	1	7,341	lichenysin	NRP	57%

JZDI01000012.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	betalactone,NRPS,transAT-PKS	1	77,183	fengycin	NRP	86%

JZDI01000018.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 91.1	transAT-PKS-like	1	24,377	difficidin	Polyketide + NRP	26%

JZDI01000232.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 150.1	RRE-containing	1	4,739

JZDI01000238.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 156.1	NRPS	1	4,670

JZDI01000240.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 159.1	NRPS	1	4,635	fengycin	NRP	13%

JZDI01000275.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 197.1	NRPS	1	4,289

JZDI01000290.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 214.1	CDPS	1	4,166

JZDI01000298.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 222.1	T3PKS	1	4,096

JZDI01000003.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 224.1	PKS-like	15,913	57,157	butirosin A / butirosin B	Saccharide	7%
Region 224.2	NRPS,RiPP-like	200,578	252,371	bacillibactin	NRP	100%

JZDI01000306.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 232.1	NRPS	1	3,987	bacitracin	NRP	44%

JZDI01000313.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 240.1	NRPS	1	3,909

JZDI01000355.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 286.1	NRPS	1	3,554	plipastatin	NRP	23%

JZDI01000038.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 313.1	NRPS	1	14,534	bacillibactin	NRP	46%

JZDI01000381.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 315.1	NRPS	1	3,315

JZDI01000392.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 327.1	NRPS	1	3,258

JZDI01000040.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 336.1	NRPS	1	13,975	fengycin	NRP	26%

JZDI01000422.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 361.1	NRPS	1	2,995

JZDI01000432.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 372.1	NRPS	1	2,943	bacitracin	NRP	33%

JZDI01000436.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 376.1	NRPS	1	2,925

JZDI01000440.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 381.1	NRPS	1	2,891	lichenysin	NRP	14%

JZDI01000005.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 446.1	transAT-PKS-like	1	46,684	difficidin	Polyketide + NRP	53%
Region 446.2	T3PKS	162,304	203,404
Region 446.3	terpene	253,782	275,665
Region 446.4	NRPS	297,245	319,108	plipastatin	NRP	30%

JZDI01000527.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 477.1	NRPS	1	2,345

JZDI01000535.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 486.1	RiPP-like	1	2,321

JZDI01000541.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 493.1	NRPS	1	2,290

JZDI01000055.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 502.1	NRPS	1	11,773	fengycin	NRP	20%

JZDI01000566.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 520.1	NRPS	1	2,169

JZDI01000057.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 524.1	RiPP-like	1	6,548

JZDI01000578.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 533.1	NRPS	1	2,090

JZDI01000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 557.1	other	326,785	368,203	bacilysin	Other	100%

JZDI01000065.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 613.1	siderophore	1	6,210

JZDI01000658.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 622.1	NRPS	1	1,797

JZDI01000068.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 646.1	cyclic-lactone-autoinducer,lanthipeptide-class-ii	1	10,807

JZDI01000007.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 668.1	transAT-PKS	222,917	257,737	difficidin	Polyketide + NRP	40%

JZDI01000725.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 697.1	NRPS	1	1,551

JZDI01000761.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 737.1	NRPS	1	1,452

JZDI01000008.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 779.1	NRPS	1	25,832	surfactin	NRP:Lipopeptide	39%

JZDI01000080.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 780.1	NRPS	1	9,963	surfactin	NRP:Lipopeptide	8%

JZDI01000813.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 795.1	NRPS	1	1,262

JZDI01000086.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 846.1	siderophore	1,036	9,313

JZDI01000009.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 890.1	lanthipeptide-class-iii	21,385	43,994	locillomycin	NRP + Polyketide	35%
Region 890.2	NRPS	141,011	169,835	surfactin	NRP:Lipopeptide	52%

Compact view

JZDI01000001.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 113,824 - 201,642 nt. (total: 87,819 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 113823 - 201642:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal) + (mal - ohmal)
Non-colinear ordering:: ctg1_141 + ctg1_142 + ctg1_145 + ctg1_143 + ctg1_147 + ctg1_144 + ctg1_146

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_141

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.8
inactive: 32.1
Methoxymalonyl-CoA: 28.6
Methylmalonyl-CoA: 20.5
Propionyl-CoA: 17.4
fatty_acid: 11.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

JZDI01000001.1 - Region 2 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 420,671 - 523,311 nt. (total: 102,641 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 420670 - 523311:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_394

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.9
inactive: 46.8
Methoxymalonyl-CoA: 38.6
Methylmalonyl-CoA: 24.5
Propionyl-CoA: 23.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_395

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 35.4
inactive: 26.4
Methoxymalonyl-CoA: 14.9
Benzoyl-CoA: 14.0
Methylmalonyl-CoA: 9.2
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_396

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.0
inactive: 28.1
Methoxymalonyl-CoA: 24.5
Methylmalonyl-CoA: 12.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_401

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.0
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg1_404

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

JZDI01000010.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 66,857 - 87,597 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000106.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 8,022 nt. (total: 8,022 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000118.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 7,341 nt. (total: 7,341 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000012.1 - Region 1 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 77,183 nt. (total: 77,183 nt) Show pHMM detection rules used

Region on contig edge.

betalactone: (HMGL-like and AMP-binding)
NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 77183:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - pro - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 26601:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 11111 - 77183:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - pro - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg25_1

Search NORINE for peptide: strict or relaxed

AMP-binding (398..790): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg25_2

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg25_6

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg25_25

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.7
inactive: 29.9
Methoxymalonyl-CoA: 21.9
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 11.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg25_26

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 625.8
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg25_27

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3286..3683): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (4325..4732): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg25_28

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1789..2188): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

JZDI01000018.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 24,377 nt. (total: 24,377 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24377:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - mal) + (mal) + (ccmal) + (mal - mal)
Non-colinear ordering:: ctg91_2 + ctg91_1 + ctg91_4 + ctg91_3

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

JZDI01000232.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 4,739 nt. (total: 4,739 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000238.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 4,670 nt. (total: 4,670 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000240.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 4,635 nt. (total: 4,635 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000275.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 4,289 nt. (total: 4,289 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000290.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 1 - 4,166 nt. (total: 4,166 nt) Show pHMM detection rules used

Region on contig edge.

CDPS: (CDPS or cycdipepsynth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000298.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,096 nt. (total: 4,096 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000003.1 - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 15,913 - 57,157 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000003.1 - Region 2 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 200,578 - 252,371 nt. (total: 51,794 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 200577 - 252371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 200577 - 247705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg224_219

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg224_221

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

JZDI01000306.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,987 nt. (total: 3,987 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg232_2

Search NORINE for peptide: strict or relaxed

AMP-binding (355..757): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSVDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

JZDI01000313.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,909 nt. (total: 3,909 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000355.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,554 nt. (total: 3,554 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000038.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 14,534 nt. (total: 14,534 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 14534:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg313_3

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPgQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)

ctg313_5

Search NORINE for peptide: strict or relaxed

AMP-binding (471..867): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1527..1943): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

JZDI01000381.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,315 nt. (total: 3,315 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg315_1

Search NORINE for peptide: strict or relaxed

AMP-binding (397..795): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMLGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

JZDI01000392.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 3,258 nt. (total: 3,258 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000040.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 13,975 nt. (total: 13,975 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13975:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg336_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg336_3

Search NORINE for peptide: strict or relaxed

AMP-binding (399..804): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

JZDI01000422.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,995 nt. (total: 2,995 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000432.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,943 nt. (total: 2,943 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000436.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,925 nt. (total: 2,925 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 2925:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg376_1

Search NORINE for peptide: strict or relaxed

AMP-binding (124..527): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

JZDI01000440.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,891 nt. (total: 2,891 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000005.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 46,684 nt. (total: 46,684 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 46684:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - mal) + (mal - ccmal) + (mal - ohmal - mal) + (ccmal - mal)
Non-colinear ordering:: ctg446_1 + ctg446_3 + ctg446_2 + ctg446_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

JZDI01000005.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 162,304 - 203,404 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000005.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 253,782 - 275,665 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000005.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 297,245 - 319,108 nt. (total: 21,864 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

JZDI01000527.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,345 nt. (total: 2,345 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000535.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 2,321 nt. (total: 2,321 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000541.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,290 nt. (total: 2,290 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 2290:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg493_1

Search NORINE for peptide: strict or relaxed

AMP-binding (2..376): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

JZDI01000055.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 11,773 nt. (total: 11,773 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11773:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg502_1

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg502_2

Search NORINE for peptide: strict or relaxed

AMP-binding (776..1169): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

JZDI01000566.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,169 nt. (total: 2,169 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000057.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 6,548 nt. (total: 6,548 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000578.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,090 nt. (total: 2,090 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000006.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 326,785 - 368,203 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

JZDI01000065.1 - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 1 - 6,210 nt. (total: 6,210 nt) Show pHMM detection rules used

Region on contig edge.

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000658.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,797 nt. (total: 1,797 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000068.1 - Region 1 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 10,807 nt. (total: 10,807 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg646_3 - Putative Class II

ctg646_2 leader / core peptide: MSHREMAAIYRDANKRANLEFSNPVGEVNEEELKNLAGA - ADVDhbPHDhbDhbPDhaDhaLPCGDhbLVDhbAVWCPDhaNACDhbDhaDC
ctg646_3 leader / core peptide: VTNPAGDLMDKLSDSEMEMLAGG - CAWCNIDhaCQLGNKGDhaWCDhbLQYKILVEDhaGRHFAGRVHLIQKKVRDhaEDhbMDDhaMLKGDhbDDhaERLEQIKFWDhaRFFYNNEEYMKRDhaLNEIDhaGINIDHILALKFGGKKDhaAVENVHPWFDDWDLILKGALDPLPARQDhbEQNKKFGDhbFIDHFLKLAFDhaKLKDhbLYIHNHDhaFDFDhaENELYDhaDLLEQMNDDIYDhaICHKDhbLVLELNVYREQGLLKGDhaDhbPEERYDYFEHEILDhbDKKFLDhaDhaFGDhaEYQDhaLIDhaLLIHKVNDhaDhaVDhaFIRDIVEHLENDWPVLIKDhbFPKIGRLRKIHLGKGDDhbHDNGKDhaVDhaILEFEGGQDhaLVYKPRPLDADQQYQKLLDhaWLNAQENNIPNFYKMKVVNADDHGWDhbEFIQYKACQDhaAEEVKDFYKRMGAQLAVLYVLNADhbDFHYGNIIAMGGHPVFVDMEDhaLFHQNIYDDDhaYDhaKEALGQADKMLDhaKDhaIMADhaGMLPNLLYQRKDRNKDhaGVDLDhaGLGGKGNQRLPFEVAQIVDKGDhbDQAYLKKGIAFLEAGLNLPDhaYNGKFVNLHDYLDhaEIVEGFDhbAVYRFMAANKVELDhbDhaQLQGFKQVRVRDhbILRPDhbAVYGEFLRDhaLVHPDLLRDPVDQEVFLHRLWLKCLQVPKMEDhaIIIDEMEDLRRHDVPLFDhbDhbRPGERHLWDhaDhaNGRVIRDFFLDhaPAFDLVLEKIRDhaLDEKDLYGQLQVLHMVMLADhaDhaADHYADVEKIDPFWNKDhbAPAKEDFLEQAVDIGNYLLKDhbKIQGVNRNKKDLDhbWIDhaDhbVLEGNNEVIWKIDhaPVGLDLYNGNDhaGIALFLAYLDhaYFDhbGEQRFKEAAEQAIVPILNDMKKFDhaENPDhbWDhaLGAYDhaGVGGNLFDhbDhbILLAELWNDDhaDhaLHQQVEKALPGYIAMINEDDhbIFDYIGGADhbGALDILLCIFHRDhbGDhaIQAVKGAIDhaCGKHLMKHGRVMKDhaGGMGWPDhaVLDGDhaVLDhbGYDhaHGDhbGGDhbAAALDhaDhaLNYWDhbENKAILPYIDhaKALEYERDhbFYDEKEKNWRDhbPGRDDhbDhaDhaYAWCHGAPGILLDhaRLRLKENGWDhbDPLLDREIEVALEDhbDhbLHKGFGNNRDhaYCHGDFGQLEILLYAKQVLQDRELDVYIEDhaVRDhaQLLEIVKQKMWNYGIDhaRGDhbEAKGLMDhbGLAGIGMGLLKQYDDhaEAVPNILNLENKLLERR
ctg646_4 leader / core peptide: MSKIEAWKNPVARMNSQIVSPAGDLMDELSDSEMEMLAGG - CEWYNIDhaCQLGNKGQWCDhbLDhbKECQRDhaCK
allorf_07634_07807 leader / core peptide: LYCAVRSRKSCFSKEGKRRKKPKILGEVSFS - DhaFMRAIHKVFCKGKDhaVFDhaLFLFDhaILV

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg646_2 - Class II

Cleavage pHMM score: 3.70

RODEO score: 0

Monoisotopic mass: 3053.4 Da

Molecular weight: 3055.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3073.4 Da N = 1; 3091.4 Da N = 2; 3109.5 Da N = 3; 3127.5 Da N = 4; 3145.5 Da N = 5; 3163.5 Da N = 6

ctg646_3 - Class II

Cleavage pHMM score: 2.80

RODEO score: 0

Monoisotopic mass: 120994.9 Da

Molecular weight: 121068.9 Da

Number of bridges: 11

Alternative weights: (assuming N unmodified Ser/Thr residues); 121087.0 Da N = 1; 121105.0 Da N = 2; 121123.0 Da N = 3; 121141.0 Da N = 4; 121159.0 Da N = 5; 121177.1 Da N = 6; 121195.1 Da N = 7; 121213.1 Da N = 8; 121231.1 Da N = 9; 121249.1 Da N = 10; 121267.2 Da N = 11; 121285.2 Da N = 12; 121303.2 Da N = 13; 121321.2 Da N = 14; 121339.2 Da N = 15; 121357.3 Da N = 16; 121375.3 Da N = 17; 121393.3 Da N = 18; 121411.3 Da N = 19; 121429.3 Da N = 20; 121447.4 Da N = 21; 121465.4 Da N = 22; 121483.4 Da N = 23; 121501.4 Da N = 24; 121519.4 Da N = 25; 121537.5 Da N = 26; 121555.5 Da N = 27; 121573.5 Da N = 28; 121591.5 Da N = 29; 121609.5 Da N = 30; 121627.6 Da N = 31; 121645.6 Da N = 32; 121663.6 Da N = 33; 121681.6 Da N = 34; 121699.6 Da N = 35; 121717.7 Da N = 36; 121735.7 Da N = 37; 121753.7 Da N = 38; 121771.7 Da N = 39; 121789.7 Da N = 40; 121807.8 Da N = 41; 121825.8 Da N = 42; 121843.8 Da N = 43; 121861.8 Da N = 44; 121879.8 Da N = 45; 121897.9 Da N = 46; 121915.9 Da N = 47; 121933.9 Da N = 48; 121951.9 Da N = 49; 121969.9 Da N = 50; 121988.0 Da N = 51; 122006.0 Da N = 52; 122024.0 Da N = 53; 122042.0 Da N = 54; 122060.0 Da N = 55; 122078.1 Da N = 56; 122096.1 Da N = 57; 122114.1 Da N = 58; 122132.1 Da N = 59; 122150.1 Da N = 60; 122168.2 Da N = 61; 122186.2 Da N = 62; 122204.2 Da N = 63; 122222.2 Da N = 64; 122240.2 Da N = 65; 122258.3 Da N = 66; 122276.3 Da N = 67; 122294.3 Da N = 68; 122312.3 Da N = 69; 122330.3 Da N = 70; 122348.4 Da N = 71; 122366.4 Da N = 72; 122384.4 Da N = 73; 122402.4 Da N = 74; 122420.4 Da N = 75; 122438.5 Da N = 76; 122456.5 Da N = 77; 122474.5 Da N = 78; 122492.5 Da N = 79; 122510.5 Da N = 80; 122528.6 Da N = 81; 122546.6 Da N = 82; 122564.6 Da N = 83; 122582.6 Da N = 84; 122600.6 Da N = 85; 122618.7 Da N = 86; 122636.7 Da N = 87; 122654.7 Da N = 88; 122672.7 Da N = 89; 122690.7 Da N = 90; 122708.8 Da N = 91; 122726.8 Da N = 92; 122744.8 Da N = 93; 122762.8 Da N = 94; 122780.8 Da N = 95; 122798.9 Da N = 96; 122816.9 Da N = 97; 122834.9 Da N = 98; 122852.9 Da N = 99; 122870.9 Da N = 100; 122889.0 Da N = 101; 122907.0 Da N = 102; 122925.0 Da N = 103; 122943.0 Da N = 104; 122961.0 Da N = 105; 122979.1 Da N = 106

ctg646_4 - Class II

Cleavage pHMM score: 2.80

RODEO score: 0

Monoisotopic mass: 3236.5 Da

Molecular weight: 3238.7 Da

Number of bridges: 4

allorf_07634_07807 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 2931.7 Da

Molecular weight: 2933.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2951.6 Da N = 1; 2969.6 Da N = 2; 2987.7 Da N = 3

JZDI01000007.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 222,917 - 257,737 nt. (total: 34,821 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 222916 - 257737:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg668_266

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.7
inactive: 30.9
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.7
Propionyl-CoA: 16.5
2-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg668_269

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

JZDI01000725.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,551 nt. (total: 1,551 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000761.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,452 nt. (total: 1,452 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000008.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,832 nt. (total: 25,832 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25832:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg779_2

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

JZDI01000080.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,963 nt. (total: 9,963 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9963:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg780_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

JZDI01000813.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,262 nt. (total: 1,262 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

JZDI01000086.1 - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 1,036 - 9,313 nt. (total: 8,278 nt) Show pHMM detection rules used

Region on contig edge.

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JZDI01000009.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 21,385 - 43,994 nt. (total: 22,610 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg890_27 - Putative Class III

allorf_034024_034194 leader / core peptide: MSVNTRKEVRKVNDVLELQKLEKETDGKGIAV - DADhbIDhbDhbDhbWDhbVDhbDhbDhbDhaGFVDhaDhaVDhaNHC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

allorf_034024_034194 - Class III

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 2299.2 Da

Molecular weight: 2300.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2318.5 Da N = 1; 2336.5 Da N = 2; 2354.5 Da N = 3; 2372.5 Da N = 4; 2390.6 Da N = 5; 2408.6 Da N = 6; 2426.6 Da N = 7; 2444.6 Da N = 8; 2462.6 Da N = 9; 2480.7 Da N = 10; 2498.7 Da N = 11

JZDI01000009.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 141,011 - 169,835 nt. (total: 28,825 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 141010 - 169835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg890_152

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)