GCA_000952875.1 - 15 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JYOG01000100.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	sactipeptide	1	10,969

JYOG01000019.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	terpene	1	12,569
Region 20.2	T3PKS	59,969	81,136

JYOG01000002.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	other	12,586	54,003	bacilysin	Other	100%

JYOG01000021.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	transAT-PKS,PKS-like,T3PKS,NRPS	1	98,835	bacillaene	Polyketide + NRP	100%

JYOG01000035.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	NRPS,betalactone	1	92,230	mycosubtilin	NRP + Polyketide	100%

JYOG01000037.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	RRE-containing,LAP	1	10,431

JYOG01000040.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	lanthipeptide-class-ii	16,233	32,337	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	50%

JYOG01000049.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 56.1	NRPS-like	25,358	50,488	surfactin	NRP:Lipopeptide	43%

JYOG01000052.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	NRPS	1	47,111	bacillibactin	NRP	100%

JYOG01000057.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 65.1	terpene	43,592	64,374

JYOG01000058.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 66.1	NRPS	1	10,783	surfactin	NRP:Lipopeptide	8%

JYOG01000071.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 81.1	NRPS	1	15,104	plipastatin	NRP	30%

JYOG01000073.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 83.1	CDPS	15,578	36,333

JYOG01000077.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 87.1	NRPS	1	28,303	surfactin	NRP:Lipopeptide	43%

Region	Type	From	To	Most similar known cluster	Similarity
Region 3.1	sactipeptide	1	10,969
Region 20.1	terpene	1	12,569
Region 20.2	T3PKS	59,969	81,136
Region 22.1	other	12,586	54,003	bacilysin	Other	100%
Region 26.1	transAT-PKS,PKS-like,T3PKS,NRPS	1	98,835	bacillaene	Polyketide + NRP	100%
Region 41.1	NRPS,betalactone	1	92,230	mycosubtilin	NRP + Polyketide	100%
Region 43.1	RRE-containing,LAP	1	10,431
Region 47.1	lanthipeptide-class-ii	16,233	32,337	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	50%
Region 56.1	NRPS-like	25,358	50,488	surfactin	NRP:Lipopeptide	43%
Region 60.1	NRPS	1	47,111	bacillibactin	NRP	100%
Region 65.1	terpene	43,592	64,374
Region 66.1	NRPS	1	10,783	surfactin	NRP:Lipopeptide	8%
Region 81.1	NRPS	1	15,104	plipastatin	NRP	30%
Region 83.1	CDPS	15,578	36,333
Region 87.1	NRPS	1	28,303	surfactin	NRP:Lipopeptide	43%

Compact view

JYOG01000100.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 1 - 10,969 nt. (total: 10,969 nt) Show pHMM detection rules used

Region on contig edge.

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

No matches found.

Sactipeptide predictions

Sactipeptides - No core peptides found.

Sactipeptides

Core peptide predictions

No core peptides found.

JYOG01000019.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 12,569 nt. (total: 12,569 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JYOG01000019.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 59,969 - 81,136 nt. (total: 21,168 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JYOG01000002.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 12,586 - 54,003 nt. (total: 41,418 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

JYOG01000021.1 - Region 1 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 98,835 nt. (total: 98,835 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 98835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal) + (ohmal - mal) + (mal - ccmal - mal) + (ohmal) + (mal) + (mal) + (X - ccmal) + (ccmal) + (ccmal - mal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 88509:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal) + (ohmal - mal) + (mal - ccmal - mal) + (ohmal) + (mal) + (mal) + (X - ccmal) + (ccmal) + (ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 49130 - 98835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - mal) + (ohmal) + (mal) + (mal) + (X - ccmal) + (ccmal) + (ccmal - mal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg26_20

PKS_AT (4..283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.6
Methoxymalonyl-CoA: 45.7
inactive: 37.0
Methylmalonyl-CoA: 29.9
Propionyl-CoA: 22.4
Ethylmalonyl-CoA: 10.1
2-Methylbutyryl-CoA: 8.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg26_21

PKS_AT (0..220): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 18.5
Malonyl-CoA: 13.7
Methylmalonyl-CoA: 10.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg26_22

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.5
inactive: 42.3
Methoxymalonyl-CoA: 27.2
Methylmalonyl-CoA: 19.2
Propionyl-CoA: 13.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg26_29

Search NORINE for peptide: strict or relaxed

AMP-binding (47..285): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: Dh--YG---K
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 40% (weak)

ctg26_43

Search NORINE for peptide: strict or relaxed

AMP-binding (498..906): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

JYOG01000035.1 - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 1 - 92,230 nt. (total: 92,230 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 92230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro - glu - D-tyr) + (ile) + (asn) + (D-asn) + (gln) + (gln - pro) + (D-asn - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg41_2

Search NORINE for peptide: strict or relaxed

AMP-binding (263..656): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg41_4

Search NORINE for peptide: strict or relaxed

AMP-binding (106..503): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1138..1538): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2176..2570): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg41_5

Search NORINE for peptide: strict or relaxed

AMP-binding (455..848): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg41_9

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg41_21

PKS_AT (6..292): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.7
inactive: 32.5
Methoxymalonyl-CoA: 23.2
Propionyl-CoA: 14.1
Methylmalonyl-CoA: 10.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg41_22

CAL_domain (0..438): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 609.4
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

ctg41_24

Search NORINE for peptide: strict or relaxed

AMP-binding (1687..2082): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg41_26

Search NORINE for peptide: strict or relaxed

AMP-binding (268..583): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg41_27

Search NORINE for peptide: strict or relaxed

AMP-binding (1172..1567): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg41_28

Search NORINE for peptide: strict or relaxed

AMP-binding (670..1003): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

ctg41_29

Search NORINE for peptide: strict or relaxed

AMP-binding (693..1089): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

ctg41_31

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2173): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

JYOG01000037.1 - Region 1 - LAP,RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 10,431 nt. (total: 10,431 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JYOG01000040.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 16,233 - 32,337 nt. (total: 16,105 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg47_23 - Putative Class II

ctg47_27 leader / core peptide: MNDNKCINNSKKELELGKYLESDMIALTDDDVVGG - IDhbPYVDhaAADhaIWVDhaKQDhbCPDhaDhbVCDhbRAC
ctg47_28 leader / core peptide: MRSEFSKLKKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGDhaWCDhaLDhaHECMAWCK
allorf_17229_17408 leader / core peptide: MNGKPQTSLQDPFLDTAEKPFELLPILSG - HLFPDhaFQLDhaQKAVMRYYHIKVQCLKIMPYF
allorf_29749_29865 leader / core peptide: LSQSFCKGGDVFNRGRIFTVRKDWAGS - IPHDhaDIWFKKC

Lanthipeptide(s) for ctg47_26 - Putative Class II

ctg47_27 leader / core peptide: MNDNKCINNSKKELELGKYLESDMIALTDDDVVGG - IDhbPYVDhaAADhaIWVDhaKQDhbCPDhaDhbVCDhbRAC
ctg47_28 leader / core peptide: MRSEFSKLKKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGDhaWCDhaLDhaHECMAWCK
allorf_17229_17408 leader / core peptide: MNGKPQTSLQDPFLDTAEKPFELLPILSG - HLFPDhaFQLDhaQKAVMRYYHIKVQCLKIMPYF
allorf_29749_29865 leader / core peptide: LSQSFCKGGDVFNRGRIFTVRKDWAGS - IPHDhaDIWFKKC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg47_27 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 2627.3 Da

Molecular weight: 2629.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2647.1 Da N = 1; 2665.1 Da N = 2; 2683.1 Da N = 3; 2701.1 Da N = 4; 2719.2 Da N = 5

ctg47_28 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3300.4 Da

Molecular weight: 3302.7 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3320.7 Da N = 1; 3338.7 Da N = 2; 3356.7 Da N = 3; 3374.8 Da N = 4

allorf_17229_17408 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3678.9 Da

Molecular weight: 3681.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3699.5 Da N = 1

allorf_29749_29865 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1354.7 Da

Molecular weight: 1355.6 Da

Number of bridges: 1

ctg47_27 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 2627.3 Da

Molecular weight: 2629.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2647.1 Da N = 1; 2665.1 Da N = 2; 2683.1 Da N = 3; 2701.1 Da N = 4; 2719.2 Da N = 5

ctg47_28 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3300.4 Da

Molecular weight: 3302.7 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3320.7 Da N = 1; 3338.7 Da N = 2; 3356.7 Da N = 3; 3374.8 Da N = 4

allorf_17229_17408 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 3678.9 Da

Molecular weight: 3681.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3699.5 Da N = 1

allorf_29749_29865 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1354.7 Da

Molecular weight: 1355.6 Da

Number of bridges: 1

JYOG01000049.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 25,358 - 50,488 nt. (total: 25,131 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 25357 - 50488:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg56_47

Search NORINE for peptide: strict or relaxed

AMP-binding (72..470): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

JYOG01000052.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 47,111 nt. (total: 47,111 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 47111:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg60_22

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

ctg60_24

Search NORINE for peptide: strict or relaxed

AMP-binding (464..862): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1520..1936): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

JYOG01000057.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 43,592 - 64,374 nt. (total: 20,783 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JYOG01000058.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,783 nt. (total: 10,783 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10783:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg66_2

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg66_3

Search NORINE for peptide: strict or relaxed

AMP-binding (355..758): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1400..1615): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAW------K
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

JYOG01000071.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 15,104 nt. (total: 15,104 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 15104:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg81_1

Search NORINE for peptide: strict or relaxed

AMP-binding (795..1200): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg81_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1903): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

JYOG01000073.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 15,578 - 36,333 nt. (total: 20,756 nt) Show pHMM detection rules used

CDPS: (CDPS or cycdipepsynth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

JYOG01000077.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 28,303 nt. (total: 28,303 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 28303:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg87_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..866): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1907): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2549..2764): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAW------K
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)