GCA_001247635.1 - 12 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LGYP01000001.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	104,242	127,283

LGYP01000010.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS,transAT-PKS,betalactone	82,279	219,690	fengycin	NRP	93%

LGYP01000011.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	terpene	8,210	30,093

LGYP01000013.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	T3PKS	895	42,139
Region 5.2	transAT-PKS	170,012	263,800	difficidin	Polyketide + NRP	100%

LGYP01000015.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS,RiPP-like	65,773	117,560	bacillibactin	NRP	100%

LGYP01000016.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	other	502,321	543,739	bacilysin	Other	100%

LGYP01000002.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	NRPS	11,832	77,240	surfactin	NRP:Lipopeptide	91%

LGYP01000007.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	PKS-like	175,458	216,702	butirosin A / butirosin B	Saccharide	7%
Region 14.2	terpene	299,485	320,225

LGYP01000009.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	transAT-PKS	133,887	220,346	macrolactin H	Polyketide	100%
Region 16.2	transAT-PKS,T3PKS,NRPS,NRPS-like	443,342	536,922	bacillaene	Polyketide + NRP	100%

Region	Type	From	To	Most similar known cluster	Similarity
Region 1.1	lanthipeptide-class-ii	104,242	127,283
Region 2.1	NRPS,transAT-PKS,betalactone	82,279	219,690	fengycin	NRP	93%
Region 3.1	terpene	8,210	30,093
Region 5.1	T3PKS	895	42,139
Region 5.2	transAT-PKS	170,012	263,800	difficidin	Polyketide + NRP	100%
Region 7.1	NRPS,RiPP-like	65,773	117,560	bacillibactin	NRP	100%
Region 8.1	other	502,321	543,739	bacilysin	Other	100%
Region 9.1	NRPS	11,832	77,240	surfactin	NRP:Lipopeptide	91%
Region 14.1	PKS-like	175,458	216,702	butirosin A / butirosin B	Saccharide	7%
Region 14.2	terpene	299,485	320,225
Region 16.1	transAT-PKS	133,887	220,346	macrolactin H	Polyketide	100%
Region 16.2	transAT-PKS,T3PKS,NRPS,NRPS-like	443,342	536,922	bacillaene	Polyketide + NRP	100%

No secondary metabolite regions were found in these records:: LGYP01000012.1; LGYP01000014.1; LGYP01000003.1; LGYP01000004.1; LGYP01000005.1; LGYP01000006.1; LGYP01000008.1

Compact view

LGYP01000001.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 104,242 - 127,283 nt. (total: 23,042 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_109 - Putative Class II

ctg1_108 leader / core peptide: MSEKQIERTIRAWKDPEFRKTLSDVADHPSGSIEARQLSMLGS - EENVNPMDhbDhbPVDhaPAPDhbVVIRVDhaLKVCPDhbFKIKCKV
allorf_105014_105088 leader / core peptide: LTGARTSGGA - CGLIRDhaNAKNLDhbRDha
allorf_105836_105952 leader / core peptide: VDALALGADEGRDEHRYA - DhaGDhaCKQALIRRFPNGEDhbHHDha
allorf_108748_108939 leader / core peptide: MYAYCYLVLREHSQWFGG - DDhaEEVDhbPVPMPNDhbEVKLFDhaADGDhaRGFDhaPCEDhaRDhbPPDhaYHYGKGDhaDhaDha
allorf_108794_108976 leader / core peptide: LVAIAKRSHPFPCRTRKLSSSAPMVVGG - FPPVRVGRRQAIIDhbVKAAHHELPFLCFDhaAYVI
allorf_108936_109136 leader / core peptide: MSCLFCVFLHTLYNM - RNVDhbICLFAKAGFMLVQDhaGNNRDRAIQLKNFAKHLIVRLKDhaNIVKVNEGGG
allorf_106877_107011 leader / core peptide: VIRLAPVHFRRRVTRPVSYYA - LFKWWLLLDhaQHPGCLDhaNDhaDhbDhaFDhaDhb
allorf_108495_108641 leader / core peptide: LRNGKSHLEGG - FMLRCFQHLDhaRPHIADhbQRCPWQNNWYDhbDhaGADhaIPVLDhaY
allorf_108766_108915 leader / core peptide: MIAWRRPTLTGG - KPPDhbDhbIGAEELNFRVRHGNGCDLFAIADhbKPLRVFDhaQN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg1_108 - Class II

Cleavage pHMM score: -3.30

RODEO score: 0

Monoisotopic mass: 3716.1 Da

Molecular weight: 3718.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3736.5 Da N = 1; 3754.5 Da N = 2; 3772.5 Da N = 3; 3790.6 Da N = 4

allorf_105014_105088 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 1477.8 Da

Molecular weight: 1478.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1496.7 Da N = 1; 1514.7 Da N = 2

allorf_105836_105952 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 2152.1 Da

Molecular weight: 2153.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2171.4 Da N = 1; 2189.4 Da N = 2; 2207.4 Da N = 3

allorf_108748_108939 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 4600.2 Da

Molecular weight: 4602.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4620.9 Da N = 1; 4639.0 Da N = 2; 4657.0 Da N = 3; 4675.0 Da N = 4; 4693.0 Da N = 5; 4711.0 Da N = 6; 4729.1 Da N = 7; 4747.1 Da N = 8; 4765.1 Da N = 9; 4783.1 Da N = 10; 4801.1 Da N = 11

allorf_108794_108976 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 3599.0 Da

Molecular weight: 3601.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3619.3 Da N = 1

allorf_108936_109136 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 5583.1 Da

Molecular weight: 5586.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5604.6 Da N = 1; 5622.6 Da N = 2

allorf_106877_107011 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 2525.3 Da

Molecular weight: 2526.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2544.9 Da N = 1; 2562.9 Da N = 2; 2580.9 Da N = 3; 2599.0 Da N = 4; 2617.0 Da N = 5; 2635.0 Da N = 6

allorf_108495_108641 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 4299.1 Da

Molecular weight: 4301.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4319.9 Da N = 1; 4337.9 Da N = 2; 4356.0 Da N = 3; 4374.0 Da N = 4

allorf_108766_108915 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 4024.1 Da

Molecular weight: 4026.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4044.6 Da N = 1; 4062.6 Da N = 2; 4080.6 Da N = 3

LGYP01000010.1 - Region 1 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 82,279 - 219,690 nt. (total: 137,412 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 82278 - 219690:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (D-thr) + (glu - D-val) + (pro - glu) + (ile) + (mal - asn) + (D-tyr - D-asn - pro - glu) + (ser) + (thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 82278 - 159110:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - pro - glu) + (ser) + (thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 142021 - 219690:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (D-thr) + (glu - D-val) + (pro - glu) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_112

Search NORINE for peptide: strict or relaxed

AMP-binding (819..1218): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg2_113

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg2_114

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3286..3683): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (4325..4732): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg2_115

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 623.2
NH2: 18.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg2_116

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.7
inactive: 30.0
Methoxymalonyl-CoA: 20.4
Propionyl-CoA: 11.8
Methylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg2_135

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg2_139

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg2_141

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2532..2924): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg2_142

Search NORINE for peptide: strict or relaxed

AMP-binding (468..873): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg2_143

Search NORINE for peptide: strict or relaxed

AMP-binding (831..1227): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg2_145

Search NORINE for peptide: strict or relaxed

AMP-binding (0..253): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (885..1290): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

LGYP01000011.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 8,210 - 30,093 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LGYP01000013.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 895 - 42,139 nt. (total: 41,245 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LGYP01000013.1 - Region 2 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 170,012 - 263,800 nt. (total: 93,789 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 170011 - 263800:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (mal) + (ohmal - mal - mal) + (mal) + (mal) + (ccmal) + (ohmal) + (mal - ohmal) + (ohmal - mal - mal) + (ccmal - mal) + (mal - ccmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_230

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg5_234

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.7
inactive: 30.9
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.7
Propionyl-CoA: 16.5
2-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

LGYP01000015.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 65,773 - 117,560 nt. (total: 51,788 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 65772 - 117560:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly) + (thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 65772 - 112899:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_94

Search NORINE for peptide: strict or relaxed

AMP-binding (392..808): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg7_95

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg7_97

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

LGYP01000016.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 502,321 - 543,739 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LGYP01000002.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 11,832 - 77,240 nt. (total: 65,409 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 11831 - 77240:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - leu) + (leu) + (val) + (asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg9_32

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg9_35

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg9_36

Search NORINE for peptide: strict or relaxed

AMP-binding (112..514): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1157..1546): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg9_37

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LGYP01000007.1 - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 175,458 - 216,702 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

LGYP01000007.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 299,485 - 320,225 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LGYP01000009.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 133,887 - 220,346 nt. (total: 86,460 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 133886 - 220346:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal) + (ccmal) + (ohmal - ohmal - mal) + (ccmal) + (ccmal - mal) + (ohmal - ccmal) + (mal - ohmal)
Non-colinear ordering:: ctg16_167 + ctg16_175 + ctg16_169 + ctg16_177 + ctg16_173 + ctg16_174 + ctg16_171 + ctg16_168 + ctg16_176

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg16_167

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.9
inactive: 31.2
Methoxymalonyl-CoA: 26.1
Methylmalonyl-CoA: 19.6
Propionyl-CoA: 16.9
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

LGYP01000009.1 - Region 2 - NRPS,NRPS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 443,342 - 536,922 nt. (total: 93,581 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 443341 - 536922:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg16_440

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.0
inactive: 46.8
Methoxymalonyl-CoA: 38.9
Methylmalonyl-CoA: 25.3
Propionyl-CoA: 23.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg16_441

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 31.9
inactive: 26.1
Methoxymalonyl-CoA: 16.2
Benzoyl-CoA: 14.0
Methylmalonyl-CoA: 9.1
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg16_442

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.6
inactive: 28.2
Methoxymalonyl-CoA: 21.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg16_448

Search NORINE for peptide: strict or relaxed

CAL_domain (1..396): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 23.4
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1065..1460): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg16_452

Search NORINE for peptide: strict or relaxed

AMP-binding (173..577): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)