GCA_001294785.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LJDI01000028.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	11,876	39,560	surfactin	NRP:Lipopeptide	47%

LJDI01000033.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	transAT-PKS	13,095	101,307	macrolactin H	Polyketide	100%

LJDI01000034.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	NRPS,RiPP-like	62,008	113,800	bacillibactin	NRP	100%

LJDI01000010.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	transAT-PKS	1	34,383	difficidin	Polyketide + NRP	46%

LJDI01000011.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	transAT-PKS-like	1	24,139	difficidin	Polyketide + NRP	26%

LJDI01000014.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	PKS-like	64,284	105,528	butirosin A / butirosin B	Saccharide	7%
Region 20.2	terpene	187,893	208,633

LJDI01000015.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS	1	9,539	surfactin	NRP:Lipopeptide	8%

LJDI01000016.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	1	25,728	surfactin	NRP:Lipopeptide	47%

LJDI01000017.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	terpene	10,334	32,217

LJDI01000005.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	other	305,791	347,209	bacilysin	Other	100%

LJDI01000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 30.1	T3PKS	5,726	46,826

LJDI01000007.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	T3PKS,transAT-PKS,NRPS	1	84,253	bacillaene	Polyketide + NRP	100%
Region 31.2	RiPP-like,NRPS,transAT-PKS,betalactone	163,716	300,000	fengycin	NRP	100%

LJDI01000008.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	transAT-PKS-like	110,709	157,166	difficidin	Polyketide + NRP	53%

LJDI01000009.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	cyclic-lactone-autoinducer,lanthipeptide-class-ii	2,525	31,940	kijanimicin	Polyketide	4%
Region 33.2	ladderane	90,489	131,610

No secondary metabolite regions were found in these records:: LJDI01000022.1; LJDI01000023.1; LJDI01000024.1; LJDI01000025.1; LJDI01000026.1; LJDI01000027.1; LJDI01000029.1; LJDI01000030.1; LJDI01000031.1; LJDI01000032.1; LJDI01000035.1; LJDI01000001.1; LJDI01000012.1; LJDI01000013.1; LJDI01000018.1; LJDI01000002.1; LJDI01000019.1; LJDI01000003.1; LJDI01000004.1

Compact view

LJDI01000028.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 11,876 - 39,560 nt. (total: 27,685 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 11875 - 39560:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_31

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LJDI01000033.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 13,095 - 101,307 nt. (total: 88,213 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 13094 - 101307:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal)
Non-colinear ordering:: ctg12_36 + ctg12_37 + ctg12_41 + ctg12_40 + ctg12_38 + ctg12_42 + ctg12_39

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg12_36

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.6
inactive: 32.0
Methoxymalonyl-CoA: 28.0
Methylmalonyl-CoA: 20.8
Propionyl-CoA: 17.4
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

LJDI01000034.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 62,008 - 113,800 nt. (total: 51,793 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 62007 - 113800:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 62007 - 109135:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_85

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg13_87

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

LJDI01000010.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 34,383 nt. (total: 34,383 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 34383:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg16_3

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg16_6

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.0
inactive: 30.6
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.3
Propionyl-CoA: 15.8
2-Methylbutyryl-CoA: 14.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

LJDI01000011.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 24,139 nt. (total: 24,139 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24139:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (mal - mal) + (mal) + (ohmal - mal - mal)
Non-colinear ordering:: ctg17_1 + ctg17_2 + ctg17_4 + ctg17_3

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

LJDI01000014.1 - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 64,284 - 105,528 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

LJDI01000014.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 187,893 - 208,633 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LJDI01000015.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,539 nt. (total: 9,539 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9539:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_3

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

LJDI01000016.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,728 nt. (total: 25,728 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25728:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_3

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LJDI01000017.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 10,334 - 32,217 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LJDI01000005.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 305,791 - 347,209 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LJDI01000006.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 5,726 - 46,826 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LJDI01000007.1 - Region 1 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 84,253 nt. (total: 84,253 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 84253:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg31_4

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.0
inactive: 46.8
Methoxymalonyl-CoA: 38.9
Methylmalonyl-CoA: 25.3
Propionyl-CoA: 23.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg31_5

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 35.4
inactive: 26.4
Methoxymalonyl-CoA: 14.9
Benzoyl-CoA: 14.0
Methylmalonyl-CoA: 9.2
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg31_6

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.8
inactive: 28.2
Methoxymalonyl-CoA: 23.4
Methylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg31_11

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.7
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg31_14

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

LJDI01000007.1 - Region 2 - NRPS,RiPP-like,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 163,716 - 300,000 nt. (total: 136,285 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)
NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 163715 - 300000:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - gln - pro) + (D-asn - ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 164197 - 239416:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - gln - pro) + (D-asn - ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 222330 - 300000:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg31_137

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2185): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg31_138

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3288..3693): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (4337..4733): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

ctg31_139

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 624.1
NH2: 17.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg31_140

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 70.4
inactive: 30.6
Methoxymalonyl-CoA: 20.4
Propionyl-CoA: 12.4
Methylmalonyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg31_159

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg31_163

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg31_164

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2532..2924): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg31_165

Search NORINE for peptide: strict or relaxed

AMP-binding (468..873): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg31_166

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg31_167

Search NORINE for peptide: strict or relaxed

AMP-binding (463..868): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1905): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

LJDI01000008.1 - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 110,709 - 157,166 nt. (total: 46,458 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 110708 - 157166:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal) + (ohmal - mal) + (ohmal - mal - mal) + (mal - ccmal)
Non-colinear ordering:: ctg32_154 + ctg32_156 + ctg32_155 + ctg32_153

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

LJDI01000009.1 - Region 1 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 2,525 - 31,940 nt. (total: 29,416 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg33_20 - Putative Class II

ctg33_19 leader / core peptide: MSIIETWKNPALRMNSQVVNPAGDLMEELSDDEMEMLAGG - CAWYDIDhaCKLGNKGAWCDhbLDhbVECQDhaDhaCN
ctg33_21 leader / core peptide: MTKQEKAAIYRDVNKHSELGLESPVGEVNEEELKNLAGA - KNVNQEEPLDhaDhaFIPGPGDhbCLDhbAAICPDhbDhbGMCNIY
allorf_018455_018688 leader / core peptide: LKGGDIMSNREKAELYRNASKRTELGFVNPVGEVSEDELRNLAGA - ADVDhbPHDhbDhbPDhaDhaLPCGVFVDhbAAFCPDhaDhbKCDhbDhaDhaC

Lanthipeptide(s) for ctg33_22 - Putative Class II

ctg33_19 leader / core peptide: MSIIETWKNPALRMNSQVVNPAGDLMEELSDDEMEMLAGG - CAWYDIDhaCKLGNKGAWCDhbLDhbVECQDhaDhaCN
ctg33_21 leader / core peptide: MTKQEKAAIYRDVNKHSELGLESPVGEVNEEELKNLAGA - KNVNQEEPLDhaDhaFIPGPGDhbCLDhbAAICPDhbDhbGMCNIY
allorf_018455_018688 leader / core peptide: LKGGDIMSNREKAELYRNASKRTELGFVNPVGEVSEDELRNLAGA - ADVDhbPHDhbDhbPDhaDhaLPCGVFVDhbAAFCPDhaDhbKCDhbDhaDhaC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg33_19 - Class II

Cleavage pHMM score: 2.80

RODEO score: 0

Monoisotopic mass: 2992.3 Da

Molecular weight: 2994.4 Da

Number of bridges: 5

ctg33_21 - Class II

Cleavage pHMM score: 3.70

RODEO score: 0

Monoisotopic mass: 3460.7 Da

Molecular weight: 3463.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3481.0 Da N = 1; 3499.0 Da N = 2; 3517.0 Da N = 3

allorf_018455_018688 - Class II

Cleavage pHMM score: 3.80

RODEO score: 0

Monoisotopic mass: 3016.4 Da

Molecular weight: 3018.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3036.4 Da N = 1; 3054.5 Da N = 2; 3072.5 Da N = 3; 3090.5 Da N = 4; 3108.5 Da N = 5; 3126.5 Da N = 6; 3144.6 Da N = 7

ctg33_19 - Class II

Cleavage pHMM score: 2.80

RODEO score: 0

Monoisotopic mass: 2992.3 Da

Molecular weight: 2994.4 Da

Number of bridges: 5

ctg33_21 - Class II

Cleavage pHMM score: 3.70

RODEO score: 0

Monoisotopic mass: 3460.7 Da

Molecular weight: 3463.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3481.0 Da N = 1; 3499.0 Da N = 2; 3517.0 Da N = 3

allorf_018455_018688 - Class II

Cleavage pHMM score: 3.80

RODEO score: 0

Monoisotopic mass: 3016.4 Da

Molecular weight: 3018.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3036.4 Da N = 1; 3054.5 Da N = 2; 3072.5 Da N = 3; 3090.5 Da N = 4; 3108.5 Da N = 5; 3126.5 Da N = 6; 3144.6 Da N = 7

LJDI01000009.1 - Region 2 - ladderane

Download region GenBank file

Download region SVG

Location: 90,489 - 131,610 nt. (total: 41,122 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.