GCA_001431285.1 - 20 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LMAG01000010.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	lanthipeptide-class-iii,NRPS	21,440	50,298	locillomycin	NRP + Polyketide	35%

LMAG01000011.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS	1	9,561	surfactin	NRP:Lipopeptide	8%

LMAG01000012.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS,RiPP-like	77,321	129,113	bacillibactin	NRP	100%
Region 4.2	lanthipeptide-class-ii	293,534	319,893
Region 4.3	other	643,809	685,227	bacilysin	Other	100%

LMAG01000014.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	NRPS	1	10,079	fengycin	NRP	13%

LMAG01000015.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	1	13,442	fengycin	NRP	20%

LMAG01000018.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS-like	1	1,358	icosalide A / icosalide B	NRP:Lipopeptide	100%

LMAG01000002.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	transAT-PKS	148,864	237,067	macrolactin H	Polyketide	100%

LMAG01000020.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	T3PKS	1,524	42,624

LMAG01000022.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS	1	6,936

LMAG01000024.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	transAT-PKS	266,843	360,482	difficidin	Polyketide + NRP	100%

LMAG01000026.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	NRPS	1	25,301	surfactin	NRP:Lipopeptide	39%

LMAG01000029.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	transAT-PKS,T3PKS,NRPS	214,857	315,904	bacillaene	Polyketide + NRP	100%
Region 20.2	NRPS,transAT-PKS,betalactone	380,625	492,926	fengycin	NRP	100%
Region 20.3	terpene	515,545	537,428

LMAG01000004.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	2	27,757	surfactin	NRP:Lipopeptide	47%
Region 22.2	transAT-PKS,NRPS	99,726	146,384	rhizocticin A	Other	6%

LMAG01000007.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	terpene	144,424	165,164
Region 25.2	PKS-like	247,168	288,412	butirosin A / butirosin B	Saccharide	7%

No secondary metabolite regions were found in these records:: LMAG01000001.1; LMAG01000013.1; LMAG01000016.1; LMAG01000017.1; LMAG01000021.1; LMAG01000025.1; LMAG01000027.1; LMAG01000028.1; LMAG01000003.1; LMAG01000005.1; LMAG01000006.1; LMAG01000008.1; LMAG01000009.1

Compact view

LMAG01000010.1 - Region 1 - NRPS,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 21,440 - 50,298 nt. (total: 28,859 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptide(s) for ctg2_29 - Putative Class III

allorf_34085_34255 leader / core peptide: MSVNTRKEVRKVNDVLELQKLEKETDGKGIAV - DADhbIDhbDhbDhbWDhbVDhbDhbDhbDhaGFVDhaDhaVDhaNHC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

allorf_34085_34255 - Class III

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 2299.2 Da

Molecular weight: 2300.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2318.5 Da N = 1; 2336.5 Da N = 2; 2354.5 Da N = 3; 2372.5 Da N = 4; 2390.6 Da N = 5; 2408.6 Da N = 6; 2426.6 Da N = 7; 2444.6 Da N = 8; 2462.6 Da N = 9; 2480.7 Da N = 10; 2498.7 Da N = 11

Predicted core structure(s)

For candidate cluster 1, location 21439 - 50298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 27552 - 50298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_45

Search NORINE for peptide: strict or relaxed

AMP-binding (248..645): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

LMAG01000011.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,561 nt. (total: 9,561 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9561:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg3_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

LMAG01000012.1 - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 77,321 - 129,113 nt. (total: 51,793 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 77320 - 129113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 77320 - 124448:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_104

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg4_106

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

LMAG01000012.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 293,534 - 319,893 nt. (total: 26,360 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_310 - Putative Class II

ctg4_307 leader / core peptide: MRLAGVPIKEIIQKLNIKNTWTCRLGLDSIELG - IYIRDhbAC
ctg4_311 leader / core peptide: MKKDMVKKASGFIEEDELISLANGDNATGG - ADhbPDhbVVLDhbADhbIGLDhbGDhbDhbFDhbVDhbLDhaAADhaCPDhbDhaACDhbKQCNK
ctg4_313 leader / core peptide: MKKTKILKTPELKVTKDLNLIDPCGDVLEEIKEHEVSGA - FNDhbWNDhbDhbDhbDhbDhaLGGILVDhaEVLGNKGKVCDhbGDhbKECQGDhbC

Lanthipeptide(s) for ctg4_312 - Putative Class II

ctg4_307 leader / core peptide: MRLAGVPIKEIIQKLNIKNTWTCRLGLDSIELG - IYIRDhbAC
ctg4_311 leader / core peptide: MKKDMVKKASGFIEEDELISLANGDNATGG - ADhbPDhbVVLDhbADhbIGLDhbGDhbDhbFDhbVDhbLDhaAADhaCPDhbDhaACDhbKQCNK
ctg4_313 leader / core peptide: MKKTKILKTPELKVTKDLNLIDPCGDVLEEIKEHEVSGA - FNDhbWNDhbDhbDhbDhbDhaLGGILVDhaEVLGNKGKVCDhbGDhbKECQGDhbC
allorf_300090_300314 leader / core peptide: VCVLFISNLKSNHFS - IVYIQYNGQIQLFLDhaIRQIRGVDhaYYFFKRAIRLKFLIHYIIDhaYGIDhaMPIFLDhbDhaLDhbWHCY
allorf_300558_300623 leader / core peptide: LAFNFLSNSLYS - FNDhbDhaFGCRK
allorf_300308_300532 leader / core peptide: LQDFCDHLGISRASYCLWKKNVKKNHCKGHLEKQIGA - LCRKHGYRQGYWIIDhbDhaLIKKGMRVNHKMLQGIMQKNQ
allorf_300348_300488 leader / core peptide: LSLEEKCEEESLQRA - FGKDhbNWRIMPKAWVDhaDhbGLLDHHFDhaNKKGNAC
allorf_316397_316627 leader / core peptide: LVLSDRNAIMKADKGRGRTPFPFFHENRLSESAGL - LQNVRVLKFPRHFRFLDhaRLPWLRRRDhaAPCPEAAICPAAEADha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg4_307 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 820.4 Da

Molecular weight: 821.0 Da

Number of bridges: 1

ctg4_311 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 3505.9 Da

Molecular weight: 3508.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3526.1 Da N = 1; 3544.1 Da N = 2; 3562.1 Da N = 3; 3580.1 Da N = 4; 3598.1 Da N = 5; 3616.2 Da N = 6; 3634.2 Da N = 7; 3652.2 Da N = 8; 3670.2 Da N = 9; 3688.2 Da N = 10; 3706.3 Da N = 11

ctg4_313 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 3666.9 Da

Molecular weight: 3669.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3687.1 Da N = 1; 3705.2 Da N = 2; 3723.2 Da N = 3; 3741.2 Da N = 4; 3759.2 Da N = 5; 3777.2 Da N = 6; 3795.3 Da N = 7

allorf_300090_300314 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 7066.9 Da

Molecular weight: 7071.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 7089.4 Da N = 1; 7107.4 Da N = 2; 7125.4 Da N = 3; 7143.5 Da N = 4; 7161.5 Da N = 5; 7179.5 Da N = 6

allorf_300558_300623 - Class II

Cleavage pHMM score: -3.10

RODEO score: 0

Monoisotopic mass: 1022.5 Da

Molecular weight: 1023.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1041.2 Da N = 1

allorf_300308_300532 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 4420.4 Da

Molecular weight: 4423.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4441.3 Da N = 1

allorf_300348_300488 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 3470.8 Da

Molecular weight: 3473.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3491.0 Da N = 1; 3509.0 Da N = 2; 3527.0 Da N = 3

allorf_316397_316627 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 4704.6 Da

Molecular weight: 4707.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4725.5 Da N = 1

ctg4_307 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 820.4 Da

Molecular weight: 821.0 Da

Number of bridges: 1

ctg4_311 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 3505.9 Da

Molecular weight: 3508.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3526.1 Da N = 1; 3544.1 Da N = 2; 3562.1 Da N = 3; 3580.1 Da N = 4; 3598.1 Da N = 5; 3616.2 Da N = 6; 3634.2 Da N = 7; 3652.2 Da N = 8; 3670.2 Da N = 9; 3688.2 Da N = 10; 3706.3 Da N = 11

ctg4_313 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 3666.9 Da

Molecular weight: 3669.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3687.1 Da N = 1; 3705.2 Da N = 2; 3723.2 Da N = 3; 3741.2 Da N = 4; 3759.2 Da N = 5; 3777.2 Da N = 6; 3795.3 Da N = 7

LMAG01000012.1 - Region 3 - other

Download region GenBank file

Download region SVG

Location: 643,809 - 685,227 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LMAG01000014.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,079 nt. (total: 10,079 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10079:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_1

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg6_2

Search NORINE for peptide: strict or relaxed

AMP-binding (232..625): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

LMAG01000015.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 13,442 nt. (total: 13,442 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13442:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_1

Search NORINE for peptide: strict or relaxed

AMP-binding (232..637): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg7_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

LMAG01000018.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 1,358 nt. (total: 1,358 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 1358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_1

Search NORINE for peptide: strict or relaxed

AMP-binding (3..253): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LMAG01000002.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 148,864 - 237,067 nt. (total: 88,204 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 148863 - 237067:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal)
Non-colinear ordering:: ctg11_180 + ctg11_181 + ctg11_185 + ctg11_184 + ctg11_182 + ctg11_186 + ctg11_183

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_180

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.6
inactive: 32.0
Methoxymalonyl-CoA: 28.0
Methylmalonyl-CoA: 20.8
Propionyl-CoA: 17.4
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

LMAG01000020.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1,524 - 42,624 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LMAG01000022.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,936 nt. (total: 6,936 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6936:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-phe) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_1

Search NORINE for peptide: strict or relaxed

AMP-binding (140..531): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTIAAICK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 100% (strong)

ctg14_2

Search NORINE for peptide: strict or relaxed

AMP-binding (264..665): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

LMAG01000024.1 - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 266,843 - 360,482 nt. (total: 93,640 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 266842 - 360482:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (ccmal - mal) + (mal - ohmal - mal) + (mal - mal) + (ccmal - ccmal) + (ccmal - ohmal - mal) + (mal - ohmal - mal) + (mal - ccmal) + (ccmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_311

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 86.6
inactive: 30.5
Methoxymalonyl-CoA: 28.9
Methylmalonyl-CoA: 21.4
Propionyl-CoA: 16.1
2-Methylbutyryl-CoA: 14.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg15_314

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

LMAG01000026.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,301 nt. (total: 25,301 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25301:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg17_2

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LMAG01000029.1 - Region 1 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 214,857 - 315,904 nt. (total: 101,048 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 214856 - 315904:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_226

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.9
inactive: 47.0
Methoxymalonyl-CoA: 40.6
Methylmalonyl-CoA: 25.5
Propionyl-CoA: 23.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_227

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 37.3
inactive: 27.1
Methoxymalonyl-CoA: 19.8
Benzoyl-CoA: 11.5
Methylmalonyl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_228

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 86.1
inactive: 31.3
Methoxymalonyl-CoA: 24.6
Methylmalonyl-CoA: 11.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_233

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 24.2
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg20_236

Search NORINE for peptide: strict or relaxed

AMP-binding (491..895): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

LMAG01000029.1 - Region 2 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 380,625 - 492,926 nt. (total: 112,302 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 380624 - 492926:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - gln - pro) + (D-asn - ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 380624 - 456980:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - gln - pro) + (D-asn - ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 439894 - 492926:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_342

Search NORINE for peptide: strict or relaxed

AMP-binding (268..663): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1778..2185): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg20_343

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3288..3693): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (4337..4733): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

ctg20_344

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 623.8
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg20_345

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.4
inactive: 30.4
Methoxymalonyl-CoA: 20.5
Propionyl-CoA: 12.0
Methylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_364

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg20_368

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg20_369

Search NORINE for peptide: strict or relaxed

AMP-binding (217..609): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg20_371

Search NORINE for peptide: strict or relaxed

AMP-binding (3..226): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg20_372

Search NORINE for peptide: strict or relaxed

AMP-binding (18..255): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

LMAG01000029.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 515,545 - 537,428 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LMAG01000004.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 2 - 27,757 nt. (total: 27,756 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 1 - 27757:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_1

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LMAG01000004.1 - Region 2 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 99,726 - 146,384 nt. (total: 46,659 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 99725 - 146384:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-asn - gly) + (ccmal) + (D-glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_110

Search NORINE for peptide: strict or relaxed

AMP-binding (1198..1599): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDIGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg22_114

PKS_AT (6..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.1
inactive: 50.8
Methoxymalonyl-CoA: 39.3
Isobutyryl-CoA: 31.6
Methylmalonyl-CoA: 29.7
Propionyl-CoA: 12.0
CHC-CoA: 10.8
fatty_acid: 10.4
Benzoyl-CoA: 10.0
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg22_115

Search NORINE for peptide: strict or relaxed

AMP-binding (140..534): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (1642..2035): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQmGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

LMAG01000007.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 144,424 - 165,164 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LMAG01000007.1 - Region 2 - PKS-like

Download region GenBank file

Download region SVG

Location: 247,168 - 288,412 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters