GCA_001686105.1 - 3 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

BCYF01000089.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	hglE-KS	1	28,976

BCYF01000094.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	RiPP-like,lanthipeptide-class-ii	102,458	121,567

BCYF01000107.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 55.1	RiPP-like	238,414	248,806

Region	Type	From	To	Similarity
Region 40.1	hglE-KS	1	28,976
Region 45.1	RiPP-like,lanthipeptide-class-ii	102,458	121,567
Region 55.1	RiPP-like	238,414	248,806

Compact view

BCYF01000089.1 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 1 - 28,976 nt. (total: 28,976 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

BCYF01000094.1 - Region 1 - RiPP-like,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 102,458 - 121,567 nt. (total: 19,110 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg45_108 - Putative Class II

allorf_112069_112179 leader / core peptide: VSNRLSPFQGA - DDhbPVGQMDhaIDhaVDhaRGCCQDhaRRGPKMA
allorf_113633_113770 leader / core peptide: MGFSPPHGCTGQGGRIASCRPLPCLVGSDGRGRVAGPGM - DhbFLPCR
allorf_114138_114269 leader / core peptide: MVTLKNDNVVGDRGDGAAAA - VGDhaARELVDGLVDhaDhaGRWIPCDhaDhaG
allorf_116852_117076 leader / core peptide: LISSVAGA - DEGDhbAFLRQDhaDhbNPDhaAADhaHVWADNLGEFLINLLLIDhaRDhaRIERDhaDhaVRVPNFADDFIFYDhaGIHLYCGYY
allorf_116953_117063 leader / core peptide: LQEQTKVPHS - CVRVQDhbHPLLAMYGLDhbILVNDhaLDhaICF
allorf_117319_117420 leader / core peptide: MGFTNLNQETSARG - IHPWPDNNADNDPLVDhaPCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

allorf_112069_112179 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 2560.3 Da

Molecular weight: 2562.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2580.0 Da N = 1; 2598.0 Da N = 2; 2616.0 Da N = 3

allorf_113633_113770 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 717.4 Da

Molecular weight: 717.9 Da

Number of bridges: 1

allorf_114138_114269 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2241.2 Da

Molecular weight: 2242.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2260.5 Da N = 1; 2278.5 Da N = 2; 2296.6 Da N = 3; 2314.6 Da N = 4

allorf_116852_117076 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 7330.7 Da

Molecular weight: 7335.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 7353.1 Da N = 1; 7371.1 Da N = 2; 7389.2 Da N = 3; 7407.2 Da N = 4; 7425.2 Da N = 5; 7443.2 Da N = 6; 7461.2 Da N = 7; 7479.3 Da N = 8; 7497.3 Da N = 9

allorf_116953_117063 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 2818.5 Da

Molecular weight: 2820.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2838.4 Da N = 1; 2856.5 Da N = 2

allorf_117319_117420 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 2087.9 Da

Molecular weight: 2089.3 Da

Number of bridges: 1

BCYF01000107.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 238,414 - 248,806 nt. (total: 10,393 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.