GCA_001876485.1 - 16 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LWJX01000004.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS	1	1,335	rhizomide A / rhizomide B / rhizomide C	NRP	100%

LWJX01000035.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	terpene	40,708	61,490

LWJX01000036.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	NRPS	1	10,536	surfactin	NRP:Lipopeptide	8%

LWJX01000044.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	betalactone	1	9,766	fengycin	NRP	40%

LWJX01000101.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 61.1	NRPS,T1PKS	48,606	129,958	zwittermicin A	NRP + Polyketide	18%

LWJX01000201.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 85.1	NRPS	28,264	75,400	bacillibactin	NRP	100%

LWJX01000217.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 91.1	other	10,917	52,335	bacilysin	Other	100%
Region 91.2	sactipeptide	57,548	69,344	subtilosin A	RiPP:Thiopeptide	100%

LWJX01000222.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 95.1	NRPS	1	25,165	surfactin	NRP:Lipopeptide	43%

LWJX01000234.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 107.1	NRPS	1	12,818	plipastatin	NRP	23%

LWJX01000241.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 114.1	terpene	15,223	37,124

LWJX01000244.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 117.1	NRPS	1	9,586	plipastatin	NRP	15%

LWJX01000251.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 124.1	NRPS	1	29,565	surfactin	NRP:Lipopeptide	43%

LWJX01000270.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 142.1	lanthipeptide-class-ii	76,906	104,786	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	70%

LWJX01000276.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 147.1	NRPS	1	11,418	plipastatin	NRP	38%

LWJX01000289.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 158.1	T3PKS	1	8,639

Compact view

LWJX01000004.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,335 nt. (total: 1,335 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

LWJX01000035.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 40,708 - 61,490 nt. (total: 20,783 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJX01000036.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,536 nt. (total: 10,536 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10536:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg27_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2546..2934): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJX01000044.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 1 - 9,766 nt. (total: 9,766 nt) Show pHMM detection rules used

Region on contig edge.

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LWJX01000101.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 48,606 - 129,958 nt. (total: 81,353 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 48605 - 129958:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-asn) + (asn - ohmal) + (glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg61_57

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg61_65

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.1
inactive: 63.4
Methoxymalonyl-CoA: 44.6
Methylmalonyl-CoA: 31.8
Propionyl-CoA: 27.2
Isobutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg61_66

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDmGnVqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg61_67

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.1
inactive: 98.0
Methoxymalonyl-CoA: 50.0
Methylmalonyl-CoA: 34.3
Propionyl-CoA: 28.4
Isobutyryl-CoA: 12.6
fatty_acid: 9.3
Benzoyl-CoA: 9.3
Acetyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg61_68

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 21.6
Methoxymalonyl-CoA: 20.1
Methylmalonyl-CoA: 11.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.1
inactive: 102.8
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 36.9
Ethylmalonyl-CoA: 24.6
fatty_acid: 19.2
Benzoyl-CoA: 17.2
Isobutyryl-CoA: 12.6
Acetyl-CoA: 11.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg61_69

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.5
inactive: 117.1
Methoxymalonyl-CoA: 74.8
Methylmalonyl-CoA: 61.3
Propionyl-CoA: 41.4
Isobutyryl-CoA: 33.1
Ethylmalonyl-CoA: 20.0
2-Methylbutyryl-CoA: 16.1
CHC-CoA: 14.3
fatty_acid: 13.3
Benzoyl-CoA: 11.6
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

LWJX01000201.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 28,264 - 75,400 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 28263 - 75400:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg85_49

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

ctg85_51

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

LWJX01000217.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 10,917 - 52,335 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LWJX01000217.1 - Region 2 - sactipeptide

Download region GenBank file

Download region SVG

Location: 57,548 - 69,344 nt. (total: 11,797 nt) Show pHMM detection rules used

Region on contig edge.

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg91_73 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg91_73: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

LWJX01000222.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,165 nt. (total: 25,165 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25165:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg95_2

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJX01000234.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 12,818 nt. (total: 12,818 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12818:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg107_1

Search NORINE for peptide: strict or relaxed

AMP-binding (130..535): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg107_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1902): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

LWJX01000241.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 15,223 - 37,124 nt. (total: 21,902 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJX01000244.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,586 nt. (total: 9,586 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg117_1

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg117_2

Search NORINE for peptide: strict or relaxed

AMP-binding (190..583): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

LWJX01000251.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 29,565 nt. (total: 29,565 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29565:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg124_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJX01000270.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 76,906 - 104,786 nt. (total: 27,881 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg142_81 - Putative Class II

ctg142_84 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPAYVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
ctg142_85 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC

Lanthipeptide(s) for ctg142_83 - Putative Class II

ctg142_84 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPAYVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
ctg142_85 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC
allorf_082126_082233 leader / core peptide: LGSKRILKRFQRRICGS - DhbAVCFQMDFQAIRFHDhaRW

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg142_84 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2535.2 Da

Molecular weight: 2536.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2554.9 Da N = 1; 2572.9 Da N = 2; 2590.9 Da N = 3; 2608.9 Da N = 4; 2627.0 Da N = 5

ctg142_85 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

ctg142_84 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2535.2 Da

Molecular weight: 2536.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2554.9 Da N = 1; 2572.9 Da N = 2; 2590.9 Da N = 3; 2608.9 Da N = 4; 2627.0 Da N = 5

ctg142_85 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

allorf_082126_082233 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 2206.1 Da

Molecular weight: 2207.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2225.5 Da N = 1

LWJX01000276.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 11,418 nt. (total: 11,418 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11418:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg147_5

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg147_6

Search NORINE for peptide: strict or relaxed

AMP-binding (129..523): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

LWJX01000289.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 8,639 nt. (total: 8,639 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.