GCA_001876515.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LWJZ01000001.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	T3PKS	170,614	211,711

LWJZ01000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	NRPS	20,928	68,064	bacillibactin	NRP	100%

LWJZ01000010.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS	107,846	133,010	surfactin	NRP:Lipopeptide	43%

LWJZ01000017.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	NRPS	1	10,534	plipastatin	NRP	23%

LWJZ01000018.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	NRPS	1	29,238	surfactin	NRP:Lipopeptide	47%

LWJZ01000020.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	T1PKS,NRPS	1	79,905	zwittermicin A	NRP + Polyketide	18%

LWJZ01000023.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS,betalactone	50,226	77,896	fengycin	NRP	80%

LWJZ01000024.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	lanthipeptide-class-ii	407	28,287	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	60%

LWJZ01000025.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	sactipeptide	118,404	140,015	subtilosin A	RiPP:Thiopeptide	100%

LWJZ01000028.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	other	53,632	89,261	bacilysin	Other	100%

LWJZ01000034.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	terpene	21,374	43,275

LWJZ01000043.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	NRPS	1	10,836	surfactin	NRP:Lipopeptide	8%

LWJZ01000045.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	terpene	95,385	116,167

LWJZ01000048.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	NRPS	1	12,818	plipastatin	NRP	23%

Region	Type	From	To	Most similar known cluster	Similarity
Region 1.1	T3PKS	170,614	211,711
Region 6.1	NRPS	20,928	68,064	bacillibactin	NRP	100%
Region 10.1	NRPS	107,846	133,010	surfactin	NRP:Lipopeptide	43%
Region 17.1	NRPS	1	10,534	plipastatin	NRP	23%
Region 18.1	NRPS	1	29,238	surfactin	NRP:Lipopeptide	47%
Region 20.1	T1PKS,NRPS	1	79,905	zwittermicin A	NRP + Polyketide	18%
Region 23.1	NRPS,betalactone	50,226	77,896	fengycin	NRP	80%
Region 24.1	lanthipeptide-class-ii	407	28,287	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	60%
Region 25.1	sactipeptide	118,404	140,015	subtilosin A	RiPP:Thiopeptide	100%
Region 28.1	other	53,632	89,261	bacilysin	Other	100%
Region 34.1	terpene	21,374	43,275
Region 43.1	NRPS	1	10,836	surfactin	NRP:Lipopeptide	8%
Region 45.1	terpene	95,385	116,167
Region 48.1	NRPS	1	12,818	plipastatin	NRP	23%

No secondary metabolite regions were found in these records:: LWJZ01000002.1; LWJZ01000003.1; LWJZ01000004.1; LWJZ01000005.1; LWJZ01000007.1; LWJZ01000008.1; LWJZ01000009.1; LWJZ01000011.1; LWJZ01000012.1; LWJZ01000013.1; LWJZ01000014.1; LWJZ01000015.1; LWJZ01000016.1; LWJZ01000019.1; LWJZ01000021.1; LWJZ01000022.1; LWJZ01000026.1; LWJZ01000027.1; LWJZ01000029.1; LWJZ01000030.1; LWJZ01000031.1; LWJZ01000032.1; LWJZ01000033.1; LWJZ01000035.1; LWJZ01000036.1; LWJZ01000037.1; LWJZ01000038.1; LWJZ01000039.1; LWJZ01000040.1; LWJZ01000041.1; LWJZ01000042.1; LWJZ01000044.1; LWJZ01000046.1; LWJZ01000047.1; LWJZ01000049.1; LWJZ01000052.1; LWJZ01000053.1; LWJZ01000054.1; LWJZ01000055.1; LWJZ01000056.1; LWJZ01000057.1; LWJZ01000059.1; LWJZ01000062.1; LWJZ01000064.1; LWJZ01000065.1; LWJZ01000066.1; LWJZ01000067.1; LWJZ01000069.1; LWJZ01000074.1; LWJZ01000076.1; LWJZ01000078.1; LWJZ01000079.1; LWJZ01000080.1; LWJZ01000081.1; LWJZ01000089.1

Compact view

LWJZ01000001.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 170,614 - 211,711 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJZ01000006.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 20,928 - 68,064 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 20927 - 68064:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_42

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg6_44

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

LWJZ01000010.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 107,846 - 133,010 nt. (total: 25,165 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 107845 - 133010:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_136

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJZ01000017.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,534 nt. (total: 10,534 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10534:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg17_1

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg17_2

Search NORINE for peptide: strict or relaxed

AMP-binding (506..899): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

LWJZ01000018.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 29,238 nt. (total: 29,238 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29238:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg18_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJZ01000020.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 79,905 nt. (total: 79,905 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 79905:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-asn) + (asn - ohmal) + (glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_16

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.5
inactive: 117.1
Methoxymalonyl-CoA: 74.8
Methylmalonyl-CoA: 61.3
Propionyl-CoA: 41.4
Isobutyryl-CoA: 33.1
Ethylmalonyl-CoA: 20.0
2-Methylbutyryl-CoA: 16.1
CHC-CoA: 14.3
fatty_acid: 13.3
Benzoyl-CoA: 11.6
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg20_17

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 21.6
Methoxymalonyl-CoA: 20.1
Methylmalonyl-CoA: 11.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.1
inactive: 102.8
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 36.9
Ethylmalonyl-CoA: 24.6
fatty_acid: 19.2
Benzoyl-CoA: 17.2
Isobutyryl-CoA: 12.6
Acetyl-CoA: 11.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_18

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.1
inactive: 98.0
Methoxymalonyl-CoA: 50.0
Methylmalonyl-CoA: 34.3
Propionyl-CoA: 28.4
Isobutyryl-CoA: 12.6
fatty_acid: 9.3
Benzoyl-CoA: 9.3
Acetyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_19

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDmGnVqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg20_20

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.1
inactive: 63.4
Methoxymalonyl-CoA: 44.6
Methylmalonyl-CoA: 31.8
Propionyl-CoA: 27.2
Isobutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg20_28

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

LWJZ01000023.1 - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 50,226 - 77,896 nt. (total: 27,671 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 50225 - 77896:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_74

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg23_79

Search NORINE for peptide: strict or relaxed

AMP-binding (492..885): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg23_80

Search NORINE for peptide: strict or relaxed

AMP-binding (208..602): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

LWJZ01000024.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 407 - 28,287 nt. (total: 27,881 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg24_12 - Putative Class II

ctg24_11 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC

Lanthipeptide(s) for ctg24_14 - Putative Class II

ctg24_11 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC
allorf_10195_10389 leader / core peptide: MTMNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPAYVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
allorf_22960_23067 leader / core peptide: LGSKRILKRFQRRICGS - DhbAVCFQMDFQAIRFHDhaRW

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg24_11 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

ctg24_11 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

allorf_10195_10389 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2535.2 Da

Molecular weight: 2536.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2554.9 Da N = 1; 2572.9 Da N = 2; 2590.9 Da N = 3; 2608.9 Da N = 4; 2627.0 Da N = 5

allorf_22960_23067 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 2206.1 Da

Molecular weight: 2207.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2225.5 Da N = 1

LWJZ01000025.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 118,404 - 140,015 nt. (total: 21,612 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg25_131 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg25_131: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

LWJZ01000028.1 - Region 1 - other

Download region GenBank file

Download region SVG

Location: 53,632 - 89,261 nt. (total: 35,630 nt) Show pHMM detection rules used

Region on contig edge.

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LWJZ01000034.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 21,374 - 43,275 nt. (total: 21,902 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJZ01000043.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,836 nt. (total: 10,836 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10836:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg43_2

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2546..2934): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJZ01000045.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 95,385 - 116,167 nt. (total: 20,783 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJZ01000048.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 12,818 nt. (total: 12,818 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12818:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg48_1

Search NORINE for peptide: strict or relaxed

AMP-binding (130..535): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg48_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1902): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)