GCA_001876645.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

LWJY01000035.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	lanthipeptide-class-ii	1	25,029	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	70%

LWJY01000111.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	NRPS	1	29,238	surfactin	NRP:Lipopeptide	47%

LWJY01000113.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	NRPS	1	2,687

LWJY01000118.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	sactipeptide	162,617	184,228	subtilosin A	RiPP:Thiopeptide	100%
Region 32.2	other	189,441	230,859	bacilysin	Other	100%

LWJY01000121.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	71,944	97,108	surfactin	NRP:Lipopeptide	43%

LWJY01000125.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	T3PKS	8,271	49,419

LWJY01000136.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	NRPS,betalactone	49,795	77,498	fengycin	NRP	80%

LWJY01000140.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 51.1	NRPS	347,220	394,356	bacillibactin	NRP	100%

LWJY01000142.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	NRPS	1	10,745	surfactin	NRP:Lipopeptide	8%

LWJY01000148.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 57.1	NRPS	1	9,292	plipastatin	NRP	15%

LWJY01000151.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 59.1	T1PKS,NRPS	1	64,033	zwittermicin A	NRP + Polyketide	18%

LWJY01000162.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 65.1	terpene	22,717	44,618

LWJY01000174.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 75.1	NRPS	1	2,339	plipastatin	NRP	15%

LWJY01000181.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 79.1	NRPS	1	1,009

LWJY01000189.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 84.1	terpene	1	1,778

LWJY01000193.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 87.1	NRPS	1	2,102

No secondary metabolite regions were found in these records:: LWJY01000001.1; LWJY01000002.1; LWJY01000009.1; LWJY01000013.1; LWJY01000014.1; LWJY01000020.1; LWJY01000024.1; LWJY01000026.1; LWJY01000031.1; LWJY01000037.1; LWJY01000038.1; LWJY01000042.1; LWJY01000046.1; LWJY01000057.1; LWJY01000068.1; LWJY01000079.1; LWJY01000084.1; LWJY01000090.1; LWJY01000101.1; LWJY01000107.1; LWJY01000108.1; LWJY01000109.1; LWJY01000110.1; LWJY01000112.1; LWJY01000114.1; LWJY01000115.1; LWJY01000116.1; LWJY01000117.1; LWJY01000119.1; LWJY01000120.1; LWJY01000122.1; LWJY01000123.1; LWJY01000124.1; LWJY01000126.1; LWJY01000127.1; LWJY01000128.1; LWJY01000129.1; LWJY01000130.1; LWJY01000131.1; LWJY01000133.1; LWJY01000135.1; LWJY01000137.1; LWJY01000139.1; LWJY01000141.1; LWJY01000143.1; LWJY01000146.1; LWJY01000147.1; LWJY01000149.1; LWJY01000153.1; LWJY01000154.1; LWJY01000155.1; LWJY01000156.1; LWJY01000159.1; LWJY01000164.1; LWJY01000165.1; LWJY01000166.1; LWJY01000167.1; LWJY01000168.1; LWJY01000169.1; LWJY01000170.1; LWJY01000172.1; LWJY01000173.1; LWJY01000175.1; LWJY01000176.1; LWJY01000178.1; LWJY01000184.1; LWJY01000185.1; LWJY01000187.1; LWJY01000188.1; LWJY01000190.1; LWJY01000192.1; LWJY01000194.1

Compact view

LWJY01000035.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 25,029 nt. (total: 25,029 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg10_6 - Putative Class II

ctg10_9 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPAYVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
ctg10_10 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC

Lanthipeptide(s) for ctg10_8 - Putative Class II

ctg10_9 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPAYVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
ctg10_10 leader / core peptide: MKTEFSKLQKEAKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbLDhaKECMAWC
allorf_02369_02476 leader / core peptide: LGSKRILKRFQRRICGS - DhbAVCFQMDFQAIRFHDhaRW

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg10_9 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2535.2 Da

Molecular weight: 2536.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2554.9 Da N = 1; 2572.9 Da N = 2; 2590.9 Da N = 3; 2608.9 Da N = 4; 2627.0 Da N = 5

ctg10_10 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

allorf_02369_02476 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 2206.1 Da

Molecular weight: 2207.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2225.5 Da N = 1

ctg10_9 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2535.2 Da

Molecular weight: 2536.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2554.9 Da N = 1; 2572.9 Da N = 2; 2590.9 Da N = 3; 2608.9 Da N = 4; 2627.0 Da N = 5

ctg10_10 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3165.4 Da

Molecular weight: 3167.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3185.6 Da N = 1; 3203.6 Da N = 2; 3221.6 Da N = 3

LWJY01000111.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 29,238 nt. (total: 29,238 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29238:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg25_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJY01000113.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,687 nt. (total: 2,687 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

LWJY01000118.1 - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 162,617 - 184,228 nt. (total: 21,612 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg32_173 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg32_173: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

LWJY01000118.1 - Region 2 - other

Download region GenBank file

Download region SVG

Location: 189,441 - 230,859 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

LWJY01000121.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 71,944 - 97,108 nt. (total: 25,165 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 71943 - 97108:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg35_96

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJY01000125.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 8,271 - 49,419 nt. (total: 41,149 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJY01000136.1 - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 49,795 - 77,498 nt. (total: 27,704 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 49794 - 77498:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg48_73

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg48_78

Search NORINE for peptide: strict or relaxed

AMP-binding (492..885): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg48_79

Search NORINE for peptide: strict or relaxed

AMP-binding (177..571): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

LWJY01000140.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 347,220 - 394,356 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 347219 - 394356:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg51_363

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

ctg51_365

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

LWJY01000142.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 10,745 nt. (total: 10,745 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10745:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-leu) + (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg53_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1903): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg53_2

Search NORINE for peptide: strict or relaxed

AMP-binding (636..1024): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

LWJY01000148.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,292 nt. (total: 9,292 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9292:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg57_1

Search NORINE for peptide: strict or relaxed

AMP-binding (468..865): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1499..1852): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg57_2

Search NORINE for peptide: strict or relaxed

AMP-binding (190..583): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

LWJY01000151.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 64,033 nt. (total: 64,033 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 64033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-asn) + (asn - ohmal) + (glu) + (ohmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg59_4

PKS_AT (534..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.5
inactive: 117.1
Methoxymalonyl-CoA: 74.8
Methylmalonyl-CoA: 61.3
Propionyl-CoA: 41.4
Isobutyryl-CoA: 33.1
Ethylmalonyl-CoA: 20.0
2-Methylbutyryl-CoA: 16.1
CHC-CoA: 14.3
fatty_acid: 13.3
Benzoyl-CoA: 11.6
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg59_5

PKS_AT (531..797): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 21.6
Methoxymalonyl-CoA: 20.1
Methylmalonyl-CoA: 11.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.1
inactive: 102.8
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 36.9
Ethylmalonyl-CoA: 24.6
fatty_acid: 19.2
Benzoyl-CoA: 17.2
Isobutyryl-CoA: 12.6
Acetyl-CoA: 11.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg59_6

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 136.1
inactive: 98.0
Methoxymalonyl-CoA: 50.0
Methylmalonyl-CoA: 34.3
Propionyl-CoA: 28.4
Isobutyryl-CoA: 12.6
fatty_acid: 9.3
Benzoyl-CoA: 9.3
Acetyl-CoA: 8.5
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg59_7

Search NORINE for peptide: strict or relaxed

AMP-binding (273..674): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDmGnVqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg59_8

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

PKS_AT (1595..1890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.1
inactive: 63.4
Methoxymalonyl-CoA: 44.6
Methylmalonyl-CoA: 31.8
Propionyl-CoA: 27.2
Isobutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg59_16

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

LWJY01000162.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 22,717 - 44,618 nt. (total: 21,902 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJY01000174.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,339 nt. (total: 2,339 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

LWJY01000181.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 1,009 nt. (total: 1,009 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

LWJY01000189.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 1,778 nt. (total: 1,778 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

LWJY01000193.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,102 nt. (total: 2,102 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 2102:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg87_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..263): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)