GCA_002271575.1 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NPCE01000019.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	lanthipeptide-class-iii,ectoine	52,820	76,583	ectoine	Other	75%

NPCE01000028.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	lanthipeptide-class-i	25,625	50,132	chejuenolide A / chejuenolide B	Polyketide	11%

NPCE01000043.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	siderophore	31,459	44,993

NPCE01000051.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	T3PKS	1	39,344

No secondary metabolite regions were found in these records:: NPCE01000001.1; NPCE01000002.1; NPCE01000003.1; NPCE01000004.1; NPCE01000005.1; NPCE01000006.1; NPCE01000007.1; NPCE01000008.1; NPCE01000009.1; NPCE01000010.1; NPCE01000011.1; NPCE01000012.1; NPCE01000013.1; NPCE01000014.1; NPCE01000018.1; NPCE01000020.1; NPCE01000021.1; NPCE01000022.1; NPCE01000023.1; NPCE01000024.1; NPCE01000025.1; NPCE01000026.1; NPCE01000027.1; NPCE01000029.1; NPCE01000030.1; NPCE01000031.1; NPCE01000032.1; NPCE01000033.1; NPCE01000034.1; NPCE01000035.1; NPCE01000036.1; NPCE01000037.1; NPCE01000038.1; NPCE01000040.1; NPCE01000041.1; NPCE01000042.1; NPCE01000044.1; NPCE01000045.1; NPCE01000046.1; NPCE01000047.1; NPCE01000048.1; NPCE01000049.1; NPCE01000050.1; NPCE01000052.1; NPCE01000053.1; NPCE01000054.1; NPCE01000055.1; NPCE01000056.1; NPCE01000057.1; NPCE01000058.1; NPCE01000060.1; NPCE01000062.1; NPCE01000063.1; NPCE01000064.1; NPCE01000065.1; NPCE01000066.1; NPCE01000067.1; NPCE01000068.1; NPCE01000069.1; NPCE01000070.1; NPCE01000071.1; NPCE01000072.1; NPCE01000073.1; NPCE01000074.1; NPCE01000075.1; NPCE01000076.1; NPCE01000077.1; NPCE01000078.1; NPCE01000079.1; NPCE01000080.1; NPCE01000081.1; NPCE01000082.1; NPCE01000083.1; NPCE01000084.1; NPCE01000085.1; NPCE01000086.1; NPCE01000087.1; NPCE01000088.1; NPCE01000089.1; NPCE01000090.1; NPCE01000091.1; NPCE01000092.1; NPCE01000093.1; NPCE01000094.1; NPCE01000095.1; NPCE01000096.1; NPCE01000097.1; NPCE01000098.1; NPCE01000099.1; NPCE01000100.1; NPCE01000101.1; NPCE01000102.1; NPCE01000103.1; NPCE01000104.1; NPCE01000105.1; NPCE01000106.1; NPCE01000107.1; NPCE01000108.1; NPCE01000109.1; NPCE01000110.1; NPCE01000111.1; NPCE01000112.1; NPCE01000113.1; NPCE01000115.1; NPCE01000116.1; NPCE01000117.1; NPCE01000118.1; NPCE01000119.1; NPCE01000120.1; NPCE01000121.1; NPCE01000122.1; NPCE01000123.1

Compact view

NPCE01000019.1 - Region 1 - ectoine,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 52,820 - 76,583 nt. (total: 23,764 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_53 - Putative Class III

ctg16_51 leader / core peptide: MNQVLELQKLSYNEESGQPAVD - KDhbPDhbDhbFDhbDhbDhbDhbDhbIDhbDhbLDhaDhbVDhaQNC
ctg16_52 leader / core peptide: MNQVLELQKLSYNEESGQPAVD - KDhbPDhbDhbFDhbDhbDhbDhbDhbIDhbDhbLDhaDhbVDhaNNC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg16_51 - Class III

Cleavage pHMM score: 2.60

RODEO score: 0

Monoisotopic mass: 2112.2 Da

Molecular weight: 2113.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2131.4 Da N = 1; 2149.4 Da N = 2; 2167.4 Da N = 3; 2185.4 Da N = 4; 2203.4 Da N = 5; 2221.5 Da N = 6; 2239.5 Da N = 7; 2257.5 Da N = 8; 2275.5 Da N = 9; 2293.5 Da N = 10; 2311.6 Da N = 11; 2329.6 Da N = 12

ctg16_52 - Class III

Cleavage pHMM score: 2.60

RODEO score: 0

Monoisotopic mass: 2098.1 Da

Molecular weight: 2099.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2117.3 Da N = 1; 2135.3 Da N = 2; 2153.4 Da N = 3; 2171.4 Da N = 4; 2189.4 Da N = 5; 2207.4 Da N = 6; 2225.4 Da N = 7; 2243.5 Da N = 8; 2261.5 Da N = 9; 2279.5 Da N = 10; 2297.5 Da N = 11; 2315.5 Da N = 12

NPCE01000028.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 25,625 - 50,132 nt. (total: 24,508 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg25_39 - Putative Class I

ctg25_38 leader / core peptide: LALFILSELMTENDVSILLKCFLQLICAGVSLAKKIGEEYQMEKAFDLDLEVVHTKAKDVEPD - FDhbDhaVDhaFCDhbPGCGEDhbGDhaFNDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg25_38 - Class I

Cleavage pHMM score: 8.70

RODEO score: 32

Monoisotopic mass: 2107.9 Da

Molecular weight: 2109.4 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2127.4 Da N = 1; 2145.4 Da N = 2; 2163.4 Da N = 3

NPCE01000043.1 - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 31,459 - 44,993 nt. (total: 13,535 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

NPCE01000051.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 39,344 nt. (total: 39,344 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.