GCA_002272545.1 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NPCB01000014.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	lanthipeptide-class-iii,ectoine	1	23,723	ectoine	Other	75%

NPCB01000026.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	lanthipeptide-class-i	1,646	26,153	chejuenolide A / chejuenolide B	Polyketide	7%

NPCB01000044.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 42.1	T3PKS	18,799	57,992

NPCB01000060.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 57.1	siderophore	32,417	45,951

No secondary metabolite regions were found in these records:: NPCB01000001.1; NPCB01000002.1; NPCB01000003.1; NPCB01000004.1; NPCB01000005.1; NPCB01000006.1; NPCB01000007.1; NPCB01000008.1; NPCB01000009.1; NPCB01000010.1; NPCB01000011.1; NPCB01000012.1; NPCB01000013.1; NPCB01000015.1; NPCB01000016.1; NPCB01000017.1; NPCB01000018.1; NPCB01000019.1; NPCB01000020.1; NPCB01000021.1; NPCB01000022.1; NPCB01000023.1; NPCB01000024.1; NPCB01000025.1; NPCB01000027.1; NPCB01000028.1; NPCB01000029.1; NPCB01000030.1; NPCB01000031.1; NPCB01000032.1; NPCB01000033.1; NPCB01000035.1; NPCB01000037.1; NPCB01000038.1; NPCB01000039.1; NPCB01000040.1; NPCB01000041.1; NPCB01000042.1; NPCB01000043.1; NPCB01000045.1; NPCB01000047.1; NPCB01000048.1; NPCB01000049.1; NPCB01000050.1; NPCB01000051.1; NPCB01000052.1; NPCB01000053.1; NPCB01000054.1; NPCB01000055.1; NPCB01000056.1; NPCB01000057.1; NPCB01000058.1; NPCB01000059.1; NPCB01000061.1; NPCB01000062.1; NPCB01000063.1; NPCB01000064.1; NPCB01000065.1; NPCB01000066.1; NPCB01000067.1; NPCB01000068.1; NPCB01000069.1; NPCB01000070.1; NPCB01000071.1; NPCB01000075.1; NPCB01000076.1; NPCB01000077.1; NPCB01000078.1; NPCB01000079.1; NPCB01000080.1; NPCB01000081.1; NPCB01000082.1; NPCB01000084.1; NPCB01000085.1; NPCB01000086.1; NPCB01000087.1; NPCB01000088.1; NPCB01000089.1; NPCB01000090.1; NPCB01000091.1; NPCB01000092.1; NPCB01000093.1; NPCB01000094.1; NPCB01000095.1; NPCB01000096.1; NPCB01000097.1; NPCB01000098.1; NPCB01000099.1; NPCB01000100.1; NPCB01000101.1; NPCB01000102.1; NPCB01000104.1; NPCB01000105.1; NPCB01000106.1; NPCB01000107.1; NPCB01000108.1; NPCB01000109.1; NPCB01000110.1; NPCB01000111.1; NPCB01000112.1; NPCB01000114.1; NPCB01000115.1; NPCB01000116.1; NPCB01000117.1; NPCB01000118.1; NPCB01000119.1; NPCB01000120.1; NPCB01000121.1; NPCB01000122.1; NPCB01000123.1; NPCB01000125.1; NPCB01000126.1; NPCB01000127.1; NPCB01000128.1; NPCB01000129.1; NPCB01000130.1; NPCB01000131.1; NPCB01000132.1; NPCB01000133.1; NPCB01000134.1; NPCB01000135.1; NPCB01000136.1; NPCB01000137.1

Compact view

NPCB01000014.1 - Region 1 - ectoine,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1 - 23,723 nt. (total: 23,723 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg14_10 - Putative Class III

allorf_09486_09629 leader / core peptide: VKKMNQVLELQKLSYNEESGQPAVD - KDhbPDhbDhbFDhbDhbDhbDhbDhbIDhbDhbLDhaDhbVDhaQNC
allorf_09702_09845 leader / core peptide: VTTMNQVLELQKLSYNEESGQPAVD - KDhbPDhbDhbFDhbDhbDhbDhbDhbIDhbDhbLDhaDhbVDhaNNC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

allorf_09486_09629 - Class III

Cleavage pHMM score: 2.60

RODEO score: 0

Monoisotopic mass: 2112.2 Da

Molecular weight: 2113.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2131.4 Da N = 1; 2149.4 Da N = 2; 2167.4 Da N = 3; 2185.4 Da N = 4; 2203.4 Da N = 5; 2221.5 Da N = 6; 2239.5 Da N = 7; 2257.5 Da N = 8; 2275.5 Da N = 9; 2293.5 Da N = 10; 2311.6 Da N = 11; 2329.6 Da N = 12

allorf_09702_09845 - Class III

Cleavage pHMM score: 2.60

RODEO score: 0

Monoisotopic mass: 2098.1 Da

Molecular weight: 2099.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2117.3 Da N = 1; 2135.3 Da N = 2; 2153.4 Da N = 3; 2171.4 Da N = 4; 2189.4 Da N = 5; 2207.4 Da N = 6; 2225.4 Da N = 7; 2243.5 Da N = 8; 2261.5 Da N = 9; 2279.5 Da N = 10; 2297.5 Da N = 11; 2315.5 Da N = 12

NPCB01000026.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1,646 - 26,153 nt. (total: 24,508 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg26_12 - Putative Class I

allorf_11319_11516 leader / core peptide: MFFTVNLRRGSLAKKIGEEYQMEKAFDLDLEVVHTKAKDVEPD - FDhbDhaVDhaFCDhbPGCGEDhbGDhaFNDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

allorf_11319_11516 - Class I

Cleavage pHMM score: 8.70

RODEO score: 29

Monoisotopic mass: 2107.9 Da

Molecular weight: 2109.4 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2127.4 Da N = 1; 2145.4 Da N = 2; 2163.4 Da N = 3

NPCB01000044.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 18,799 - 57,992 nt. (total: 39,194 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

NPCB01000060.1 - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 32,417 - 45,951 nt. (total: 13,535 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.