GCA_003833235.1 - 16 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

RPHF01000001.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	82,556	110,433	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	80%
Region 1.2	other	325,863	367,281	bacilysin	Other	100%
Region 1.3	sactipeptide	374,366	395,977	subtilosin A	RiPP:Thiopeptide	100%
Region 1.4	NRPS	943,780	990,916	bacillibactin	NRP	100%

RPHF01000011.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS	1	13,086	plipastatin	NRP	30%

RPHF01000012.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS	1	9,963	fengycin	NRP	26%

RPHF01000013.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	1	9,340	surfactin	NRP:Lipopeptide	8%

RPHF01000002.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	lanthipeptide-class-ii	51,482	74,598
Region 9.2	T3PKS	881,232	922,329
Region 9.3	terpene	970,070	991,968
Region 9.4	NRPS	1,051,994	1,073,629	plipastatin	NRP	30%

RPHF01000003.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	terpene	198,545	219,348
Region 11.2	transAT-PKS,PKS-like,T3PKS,NRPS	817,191	922,438	bacillaene	Polyketide + NRP	100%
Region 11.3	NRPS,betalactone	1,020,154	1,047,727	fengycin	NRP	73%

RPHF01000005.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	NRPS	222,871	248,292	surfactin	NRP:Lipopeptide	43%

RPHF01000006.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS	1	28,598	surfactin	NRP:Lipopeptide	43%

Compact view

RPHF01000001.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 82,556 - 110,433 nt. (total: 27,878 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_100 - Putative Class II

ctg1_98 leader / core peptide: MKTEFSKLQKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbVDhaKECMAWC
ctg1_99 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPALDhaVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC

Lanthipeptide(s) for ctg1_102 - Putative Class II

ctg1_98 leader / core peptide: MKTEFSKLQKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbVDhaKECMAWC
ctg1_99 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPALDhaVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
ctg1_107 leader / core peptide: MSGKVRDYTRLAKDILEAVGGEENVIGT - DhaRCADhbRLRLVLKRDhaDhbPKAKGRIDha
allorf_0102081_0102281 leader / core peptide: MWGSEIHSLGSFLRSLIYHSKLLARSVMLFFS - FPEYLKNDhbNDhbNIIDhaKKIINCCVLKARDhbHFWAVDhaA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg1_98 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3151.3 Da

Molecular weight: 3153.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3171.6 Da N = 1; 3189.6 Da N = 2; 3207.6 Da N = 3

ctg1_99 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2554.3 Da

Molecular weight: 2555.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2573.9 Da N = 1; 2591.9 Da N = 2; 2610.0 Da N = 3; 2628.0 Da N = 4; 2646.0 Da N = 5; 2664.0 Da N = 6

ctg1_107 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 2506.6 Da

Molecular weight: 2508.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2526.0 Da N = 1; 2544.1 Da N = 2; 2562.1 Da N = 3; 2580.1 Da N = 4

allorf_0102081_0102281 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 3832.1 Da

Molecular weight: 3834.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3852.5 Da N = 1; 3870.5 Da N = 2; 3888.6 Da N = 3

ctg1_98 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3151.3 Da

Molecular weight: 3153.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3171.6 Da N = 1; 3189.6 Da N = 2; 3207.6 Da N = 3

ctg1_99 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2554.3 Da

Molecular weight: 2555.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2573.9 Da N = 1; 2591.9 Da N = 2; 2610.0 Da N = 3; 2628.0 Da N = 4; 2646.0 Da N = 5; 2664.0 Da N = 6

RPHF01000001.1 - Region 2 - other

Download region GenBank file

Download region SVG

Location: 325,863 - 367,281 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

RPHF01000001.1 - Region 3 - sactipeptide

Download region GenBank file

Download region SVG

Location: 374,366 - 395,977 nt. (total: 21,612 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg1_388 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg1_388: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

RPHF01000001.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 943,780 - 990,916 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 943779 - 990916:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_966

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

ctg1_968

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

RPHF01000011.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 13,086 nt. (total: 13,086 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13086:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg3_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1903): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg3_3

Search NORINE for peptide: strict or relaxed

AMP-binding (177..582): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

RPHF01000012.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,963 nt. (total: 9,963 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9963:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_1

Search NORINE for peptide: strict or relaxed

AMP-binding (106..503): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1137..1538): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg4_3

Search NORINE for peptide: strict or relaxed

AMP-binding (178..571): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

RPHF01000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,340 nt. (total: 9,340 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9340:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

RPHF01000002.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 51,482 - 74,598 nt. (total: 23,117 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg9_61 - Putative Class II

ctg9_59 leader / core peptide: MENNFKNPVLRSKKLNEKHPAGNLLEEINEQDMSSIAGG - DhbNDAYDhaKDhaLANRAGLGNNYGKYCDhbVDhaAECFGDhbIDhaCGDha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg9_59 - Class II

Cleavage pHMM score: -1.20

RODEO score: 0

Monoisotopic mass: 3677.7 Da

Molecular weight: 3680.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3698.0 Da N = 1; 3716.0 Da N = 2; 3734.0 Da N = 3; 3752.1 Da N = 4; 3770.1 Da N = 5

RPHF01000002.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 881,232 - 922,329 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

RPHF01000002.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 970,070 - 991,968 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

RPHF01000002.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 1,051,994 - 1,073,629 nt. (total: 21,636 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

RPHF01000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 198,545 - 219,348 nt. (total: 20,804 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

RPHF01000003.1 - Region 2 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 817,191 - 922,438 nt. (total: 105,248 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 817190 - 922438:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal - mal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 817190 - 907770:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal - mal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_859

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.2
Methoxymalonyl-CoA: 53.7
inactive: 37.1
Methylmalonyl-CoA: 34.6
Propionyl-CoA: 22.3
Ethylmalonyl-CoA: 10.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg11_860

PKS_AT (7..293): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 30.4
Malonyl-CoA: 24.5
Isobutyryl-CoA: 8.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg11_861

PKS_AT (4..288): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.0
inactive: 41.2
Methoxymalonyl-CoA: 29.1
Methylmalonyl-CoA: 22.1
Propionyl-CoA: 16.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg11_867

Search NORINE for peptide: strict or relaxed

CAL_domain (60..471): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.2
NH2: 10.3
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1159..1554): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg11_870

Search NORINE for peptide: strict or relaxed

AMP-binding (497..905): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

RPHF01000003.1 - Region 3 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 1,020,154 - 1,047,727 nt. (total: 27,574 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 1020153 - 1047727:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_1005

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg11_1009

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg11_1010

Search NORINE for peptide: strict or relaxed

AMP-binding (176..570): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

RPHF01000005.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 222,871 - 248,292 nt. (total: 25,422 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 222870 - 248292:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_260

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

RPHF01000006.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 28,598 nt. (total: 28,598 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 28598:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2865): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)