GCA_007362635.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

CP041691.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	NRPS	314,623	379,675	surfactin	NRP:Lipopeptide	82%
Region 2	phosphonate	625,719	666,603
Region 3	PKS-like	942,322	983,566	butirosin A / butirosin B	Saccharide	7%
Region 4	terpene	1,068,773	1,085,351
Region 5	transAT-PKS	1,439,711	1,527,545	macrolactin H	Polyketide	100%
Region 6	transAT-PKS,T3PKS,NRPS	1,749,663	1,849,948	bacillaene	Polyketide + NRP	100%
Region 7	NRPS,transAT-PKS,betalactone	1,926,173	2,060,851	fengycin	NRP	100%
Region 8	terpene	2,089,507	2,111,390
Region 9	T3PKS	2,161,754	2,202,854
Region 10	transAT-PKS	2,373,597	2,467,383	difficidin	Polyketide + NRP	100%
Region 11	NRPS,RiPP-like	3,105,153	3,155,662	bacillibactin	NRP	100%
Region 12	NRPS	3,436,776	3,505,196
Region 13	other	3,707,421	3,748,839	bacilysin	Other	100%
Region 14	lanthipeptide-class-ii	3,903,898	3,927,086	mersacidin	RiPP:Lanthipeptide	100%

CP041691.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 314,623 - 379,675 nt. (total: 65,053 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 314622 - 379675:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_315

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg1_316

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2547..2936): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg1_317

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

CP041691.1 - Region 2 - phosphonate

Download region GenBank file

Download region SVG

Location: 625,719 - 666,603 nt. (total: 40,885 nt) Show pHMM detection rules used

phosphonate: phosphonates

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP041691.1 - Region 3 - PKS-like

Download region GenBank file

Download region SVG

Location: 942,322 - 983,566 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

CP041691.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 1,068,773 - 1,085,351 nt. (total: 16,579 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP041691.1 - Region 5 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1,439,711 - 1,527,545 nt. (total: 87,835 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 5, location 1439710 - 1527545:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal)
Non-colinear ordering:: ctg1_1472 + ctg1_1473 + ctg1_1477 + ctg1_1476 + ctg1_1474 + ctg1_1478 + ctg1_1475

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1472

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.6
inactive: 32.0
Methoxymalonyl-CoA: 28.0
Methylmalonyl-CoA: 20.8
Propionyl-CoA: 17.4
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

CP041691.1 - Region 6 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1,749,663 - 1,849,948 nt. (total: 100,286 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 6, location 1749662 - 1849948:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1730

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 98.2
inactive: 51.6
Methoxymalonyl-CoA: 36.5
Methylmalonyl-CoA: 23.7
Propionyl-CoA: 20.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_1731

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 32.7
inactive: 24.8
Benzoyl-CoA: 13.9
Methoxymalonyl-CoA: 12.4
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_1732

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.4
inactive: 28.2
Methoxymalonyl-CoA: 23.4
Methylmalonyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_1737

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.0
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg1_1740

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

CP041691.1 - Region 7 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1,926,173 - 2,060,851 nt. (total: 134,679 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 7, location 1926172 - 2060851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - pro - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 1926172 - 2002571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - pro - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 1987609 - 2060851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1863

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1789..2188): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_1864

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3286..3683): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (4325..4732): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg1_1865

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 621.2
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg1_1866

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.7
inactive: 29.9
Methoxymalonyl-CoA: 21.9
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 11.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_1885

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg1_1889

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg1_1890

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2532..2924): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg1_1891

Search NORINE for peptide: strict or relaxed

AMP-binding (468..873): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg1_1892

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_1893

Search NORINE for peptide: strict or relaxed

AMP-binding (463..868): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1905): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

CP041691.1 - Region 8 - terpene

Download region GenBank file

Download region SVG

Location: 2,089,507 - 2,111,390 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP041691.1 - Region 9 - T3PKS

Download region GenBank file

Download region SVG

Location: 2,161,754 - 2,202,854 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP041691.1 - Region 10 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 2,373,597 - 2,467,383 nt. (total: 93,787 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 12, location 2373596 - 2467383:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - mal) + (ohmal - mal - mal) + (mal - mal) + (ccmal - ccmal - ohmal - mal) + (ohmal - mal - mal) + (ccmal - mal) + (mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_2293

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg1_2296

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.7
inactive: 30.9
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.7
Propionyl-CoA: 16.5
2-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CP041691.1 - Region 11 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 3,105,153 - 3,155,662 nt. (total: 50,510 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 13, location 3105152 - 3155662:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 14, location 3105152 - 3150662:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_2983

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_2985

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

CP041691.1 - Region 12 - NRPS

Download region GenBank file

Download region SVG

Location: 3,436,776 - 3,505,196 nt. (total: 68,421 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 16, location 3436775 - 3505196:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-cys - ser - cys - ala) + (X - asn - D-asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_3315

Search NORINE for peptide: strict or relaxed

AMP-binding (299..683): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DqgSeGtVnK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 50% (weak)

AMP-binding (1320..1708): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (2346..2734): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg1_3316

Search NORINE for peptide: strict or relaxed

CAL_domain (44..474): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 110.1
Acetyl-CoA: 26.6
NH2: 24.7
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1130..1514): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNmSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2620..3019): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWqIiLVnK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (3938..4322): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNmSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (4966..5359): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DVWCIAmvYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

CP041691.1 - Region 13 - other

Download region GenBank file

Download region SVG

Location: 3,707,421 - 3,748,839 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

CP041691.1 - Region 14 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 3,903,898 - 3,927,086 nt. (total: 23,189 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_3757 - Putative Class II

ctg1_3754 leader / core peptide: MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGA - GDMEAACDhbFDhbLPGGGGVCDhbLDhbDhaECIC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg1_3754 - Class II

Cleavage pHMM score: -2.00

RODEO score: 0

Monoisotopic mass: 2399.0 Da

Molecular weight: 2400.8 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2418.8 Da N = 1