GCA_013267115.1 - 11 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JABRUZ010000001 (original name was: JABRUZ010000001.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS,transAT-PKS,T3PKS,PKS-like	23,404	128,664	bacillaene	Polyketide + NRP	100%

JABRUZ010000010 (original name was: JABRUZ010000010.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	5,152	52,288	bacillibactin	NRP	100%
Region 2.2	CDPS	336,004	356,750

JABRUZ010000011 (original name was: JABRUZ010000011.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	T3PKS	122,953	158,379

JABRUZ010000012 (original name was: JABRUZ010000012.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	lanthipeptide-class-ii	1	21,341

JABRUZ010000003 (original name was: JABRUZ010000003.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	other	190,700	232,118	bacilysin	Other	100%
Region 22.2	sactipeptide	234,859	256,470	subtilosin A	RiPP:Thiopeptide	100%

JABRUZ010000032 (original name was: JABRUZ010000032.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	terpene	1	14,150

JABRUZ010000005 (original name was: JABRUZ010000005.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	terpene	52,051	72,854

JABRUZ010000006 (original name was: JABRUZ010000006.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS	115,459	180,847	surfactin	NRP:Lipopeptide	82%

JABRUZ010000007 (original name was: JABRUZ010000007.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	NRPS,betalactone	35,098	97,485	fengycin	NRP	100%

No secondary metabolite regions were found in these records:: JABRUZ010000013 (original name was: JABRUZ010000013.1); JABRUZ010000014 (original name was: JABRUZ010000014.1); JABRUZ010000015 (original name was: JABRUZ010000015.1); JABRUZ010000016 (original name was: JABRUZ010000016.1); JABRUZ010000017 (original name was: JABRUZ010000017.1); JABRUZ010000018 (original name was: JABRUZ010000018.1); JABRUZ010000019 (original name was: JABRUZ010000019.1); JABRUZ010000002 (original name was: JABRUZ010000002.1); JABRUZ010000020 (original name was: JABRUZ010000020.1); JABRUZ010000022 (original name was: JABRUZ010000022.1); JABRUZ010000023 (original name was: JABRUZ010000023.1); JABRUZ010000024 (original name was: JABRUZ010000024.1); JABRUZ010000025 (original name was: JABRUZ010000025.1); JABRUZ010000026 (original name was: JABRUZ010000026.1); JABRUZ010000027 (original name was: JABRUZ010000027.1); JABRUZ010000028 (original name was: JABRUZ010000028.1); JABRUZ010000029 (original name was: JABRUZ010000029.1); JABRUZ010000031 (original name was: JABRUZ010000031.1); JABRUZ010000034 (original name was: JABRUZ010000034.1); JABRUZ010000035 (original name was: JABRUZ010000035.1); JABRUZ010000036 (original name was: JABRUZ010000036.1); JABRUZ010000038 (original name was: JABRUZ010000038.1); JABRUZ010000039 (original name was: JABRUZ010000039.1); JABRUZ010000004 (original name was: JABRUZ010000004.1); JABRUZ010000008 (original name was: JABRUZ010000008.1); JABRUZ010000009 (original name was: JABRUZ010000009.1)

Compact view

c00001_JABRUZ0.. - Region 1 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 23,404 - 128,664 nt. (total: 105,261 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 23403 - 128664:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (ccmal - mal - ohmal - mal - mal) + (ccmal - ohmal - mal - mal) + (X - ccmal - ccmal - ccmal) + (mal - mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 38074 - 128664:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (ccmal - mal - ohmal - mal - mal) + (ccmal - ohmal - mal - mal) + (X - ccmal - ccmal - ccmal) + (mal - mal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_41

Search NORINE for peptide: strict or relaxed

AMP-binding (497..905): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

ctg1_44

Search NORINE for peptide: strict or relaxed

CAL_domain (60..471): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.2
NH2: 10.3
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1159..1554): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg1_50

PKS_AT (4..288): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.0
inactive: 41.2
Methoxymalonyl-CoA: 29.1
Methylmalonyl-CoA: 22.1
Propionyl-CoA: 16.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_51

PKS_AT (7..293): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 30.0
Malonyl-CoA: 23.0
Benzoyl-CoA: 8.8
Isobutyryl-CoA: 8.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_54

PKS_AT (4..284): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 96.7
Methoxymalonyl-CoA: 50.0
inactive: 35.3
Methylmalonyl-CoA: 31.5
Propionyl-CoA: 22.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00002_JABRUZ0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 5,152 - 52,288 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 5151 - 52288:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_27

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg2_29

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

c00002_JABRUZ0.. - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 336,004 - 356,750 nt. (total: 20,747 nt) Show pHMM detection rules used

CDPS: (CDPS or cycdipepsynth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00003_JABRUZ0.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 122,953 - 158,379 nt. (total: 35,427 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00004_JABRUZ0.. - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 21,341 nt. (total: 21,341 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_9 - Putative Class II

ctg4_5 leader / core peptide: MELRMSNIG - YDhaYIIYGDDhbRDNCMEDKIMNVKLKVANNDK
ctg4_10 leader / core peptide: MQWKNQMENLNAYNPVGSVLSELTDTEMDTVAGG - AQALGFDhbDGNCLADhaIDhbADCDhbPWIWGC
allorf_001112_001255 leader / core peptide: LAILKLFMFQSFYG - GGFLDhaKAVYIGDhaDhbPIFHCWKIPIDFIRFYFHHE
allorf_012396_012518 leader / core peptide: MDCYYIKSQVLGM - DGDhaDhbLAYLFADhbKPCLQNNVKMIMLPLK
allorf_012427_012570 leader / core peptide: MGGEVVSEFGG - AAGGILNGLLLYQVDhbGDhaRNGWEYDhaGLDhaICNKDhbLFAK
allorf_014349_014459 leader / core peptide: MRSASFAA - DILCDIYRDhaFPDhaDhaYIVKLLKNFLFFFRI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg4_5 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 3516.7 Da

Molecular weight: 3519.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3537.0 Da N = 1

ctg4_10 - Class II

Cleavage pHMM score: 4.60

RODEO score: 0

Monoisotopic mass: 2641.2 Da

Molecular weight: 2643.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2661.0 Da N = 1

allorf_001112_001255 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 3871.0 Da

Molecular weight: 3873.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3891.5 Da N = 1; 3909.5 Da N = 2

allorf_012396_012518 - Class II

Cleavage pHMM score: -1.80

RODEO score: 0

Monoisotopic mass: 2954.6 Da

Molecular weight: 2956.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2974.6 Da N = 1; 2992.6 Da N = 2

allorf_012427_012570 - Class II

Cleavage pHMM score: -2.60

RODEO score: 0

Monoisotopic mass: 3724.0 Da

Molecular weight: 3726.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3744.3 Da N = 1; 3762.3 Da N = 2; 3780.3 Da N = 3; 3798.3 Da N = 4

allorf_014349_014459 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 3402.9 Da

Molecular weight: 3405.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3423.1 Da N = 1; 3441.1 Da N = 2

c00022_JABRUZ0.. - Region 1 - other

Download region GenBank file

Download region SVG

Location: 190,700 - 232,118 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00022_JABRUZ0.. - Region 2 - sactipeptide

Download region GenBank file

Download region SVG

Location: 234,859 - 256,470 nt. (total: 21,612 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg22_242 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg22_242: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

c00024_JABRUZ0.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 14,150 nt. (total: 14,150 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00031_JABRUZ0.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 52,051 - 72,854 nt. (total: 20,804 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00032_JABRUZ0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 115,459 - 180,847 nt. (total: 65,389 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 115458 - 180847:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_150

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg32_151

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1501..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2546..2933): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg32_152

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00033_JABRUZ0.. - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 35,098 - 97,485 nt. (total: 62,388 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 35097 - 97485:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg33_58

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg33_62

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg33_63

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2539..2933): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg33_64

Search NORINE for peptide: strict or relaxed

AMP-binding (469..870): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1903): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg33_65

Search NORINE for peptide: strict or relaxed

AMP-binding (474..865): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1903): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg33_66

Search NORINE for peptide: strict or relaxed

AMP-binding (463..864): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1503..1908): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)