GCA_017299595.1 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

CP071248.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	RiPP-like	1,089,495	1,098,528
Region 2	lanthipeptide-class-i,lassopeptide	1,144,914	1,174,456	microbisporicin A2	RiPP:Lanthipeptide	10%
Region 3	RiPP-like	2,290,236	2,300,628
Region 4	NRPS-like	2,565,560	2,608,571	nosiheptide	RiPP:Thiopeptide	7%

CP071248.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,089,495 - 1,098,528 nt. (total: 9,034 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP071248.1 - Region 2 - lanthipeptide-class-i,lassopeptide

Download region GenBank file

Download region SVG

Location: 1,144,914 - 1,174,456 nt. (total: 29,543 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lasso peptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_983 - Putative Class I

ctg1_984 leader / core peptide: MNTAILEKPTVDVMDIDLDIDVEDLPVEQIDQ - IRLDhbDhaIDhaLCDhbPGCDhbDhaPNGGDhaGCDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lasso peptide predictions

Lassopeptide(s) for ctg1_989 - Putative Class II

ctg1_989 leader / core peptide / cleaved tail: MKDYVPPAVEVIASFKEATN - GVWFGNYVDVGGAKAPFPWGSN

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lanthipeptides

Lasso peptides

Core peptide predictions

ctg1_984 - Class I

Cleavage pHMM score: -10.80

RODEO score: 29

Monoisotopic mass: 2419.1 Da

Molecular weight: 2420.8 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2438.8 Da N = 1; 2456.8 Da N = 2; 2474.9 Da N = 3

Core peptide predictions

ctg1_989 - Class II: Cleavage pHMM score: -3.90; RODEO score: 18; Monoisotopic mass: 2306.1 Da; Molecular weight: 2307.5 Da; Number of bridges: 0

CP071248.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,290,236 - 2,300,628 nt. (total: 10,393 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

CP071248.1 - Region 4 - NRPS-like

Download region GenBank file

Download region SVG

Location: 2,565,560 - 2,608,571 nt. (total: 43,012 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 6, location 2565559 - 2608571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_2263

Search NORINE for peptide: strict or relaxed

AMP-binding (14..381): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfftIGiIYK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)