GCA_017601115.1 - 22 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JAGFPW010000012 (original name was: JAGFPW010000012.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS,betalactone	41,272	91,132	fengycin	NRP	93%

JAGFPW010000013 (original name was: JAGFPW010000013.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS-like	87,634	109,902

JAGFPW010000014 (original name was: JAGFPW010000014.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	terpene	36,367	58,265

JAGFPW010000015 (original name was: JAGFPW010000015.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	transAT-PKS,T3PKS	1	51,195	myxovirescin A1	NRP + Polyketide:Trans-AT type I	13%

JAGFPW010000002 (original name was: JAGFPW010000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	RRE-containing	3,399	22,868
Region 12.2	lanthipeptide-class-i	171,269	197,494	subtilin	RiPP:Lanthipeptide	100%

JAGFPW010000023 (original name was: JAGFPW010000023.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	sactipeptide	2,591	23,313	rhizocticin A	Other	38%

JAGFPW010000029 (original name was: JAGFPW010000029.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	1	27,905	surfactin	NRP:Lipopeptide	43%

JAGFPW010000003 (original name was: JAGFPW010000003.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	terpene	5,197	26,000

JAGFPW010000030 (original name was: JAGFPW010000030.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	sactipeptide	15,275	36,886	subtilosin A	RiPP:Thiopeptide	100%

JAGFPW010000037 (original name was: JAGFPW010000037.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	PKS-like,T1PKS,transAT-PKS-like	1	32,245	macrobrevin	Polyketide:Trans-AT type I	26%

JAGFPW010000004 (original name was: JAGFPW010000004.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	lanthipeptide-class-ii	83,786	111,663	staphylococcin C55 α / staphylococcin C55 β	RiPP:Lanthipeptide	80%
Region 34.2	RiPP-like	129,233	143,103

JAGFPW010000050 (original name was: JAGFPW010000050.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	NRPS	1	9,207	surfactin	NRP:Lipopeptide	8%

JAGFPW010000051 (original name was: JAGFPW010000051.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	transAT-PKS-like	1	7,383	elansolid A1	Polyketide:Trans-AT type I	15%

JAGFPW010000052 (original name was: JAGFPW010000052.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	NRPS	1	6,850

JAGFPW010000054 (original name was: JAGFPW010000054.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 50.1	NRPS	1	5,718	tridecaptin	NRP	40%

JAGFPW010000056 (original name was: JAGFPW010000056.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 52.1	NRPS	1	4,774

JAGFPW010000006 (original name was: JAGFPW010000006.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 56.1	T3PKS	74,642	115,738

JAGFPW010000060 (original name was: JAGFPW010000060.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 57.1	NRPS	1	2,047

JAGFPW010000007 (original name was: JAGFPW010000007.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 65.1	NRPS	1	25,169	surfactin	NRP:Lipopeptide	39%

JAGFPW010000009 (original name was: JAGFPW010000009.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	NRPS	72,694	119,830	bacillibactin	NRP	100%

Compact view

c00004_JAGFPW0.. - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 41,272 - 91,132 nt. (total: 49,861 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 41271 - 91132:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-tyr) + (ile) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_66

Search NORINE for peptide: strict or relaxed

AMP-binding (13..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg4_73

Search NORINE for peptide: strict or relaxed

AMP-binding (474..825): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg4_74

Search NORINE for peptide: strict or relaxed

AMP-binding (1..329): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (967..1361): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00005_JAGFPW0.. - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 87,634 - 109,902 nt. (total: 22,269 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 87633 - 109902:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_107

Search NORINE for peptide: strict or relaxed

AMP-binding (0..328): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvFYLGgiCK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

c00006_JAGFPW0.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 36,367 - 58,265 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00007_JAGFPW0.. - Region 1 - T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 51,195 nt. (total: 51,195 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 51195:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 49750:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 9929 - 51195:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_4

PKS_AT (5..289): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 12.6
Malonyl-CoA: 11.4
inactive: 9.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (321..601): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.5
inactive: 31.5
Methoxymalonyl-CoA: 25.9
Methylmalonyl-CoA: 24.9
Propionyl-CoA: 14.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00012_JAGFPW0.. - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 3,399 - 22,868 nt. (total: 19,470 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00012_JAGFPW0.. - Region 2 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 171,269 - 197,494 nt. (total: 26,226 nt) Show pHMM detection rules used

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg12_177 - Putative Class I

ctg12_180 leader / core peptide: MSKFDDFDLDVVKVSKQDSKITPQ - WKDhaEDhaLCDhbPGCVDhbGVLQDhbCFLQDhbIDhbCNCKIDhaK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg12_180 - Class I

Cleavage pHMM score: 27.80

RODEO score: 29

Monoisotopic mass: 3346.7 Da

Molecular weight: 3349.0 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 3367.0 Da N = 1; 3385.0 Da N = 2; 3403.0 Da N = 3

c00016_JAGFPW0.. - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 2,591 - 23,313 nt. (total: 20,723 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Sactipeptides - No core peptides found.

Sactipeptides

Core peptide predictions

No core peptides found.

c00022_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 27,905 nt. (total: 27,905 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27905:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_1

Search NORINE for peptide: strict or relaxed

AMP-binding (466..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1510..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00023_JAGFPW0.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 5,197 - 26,000 nt. (total: 20,804 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00024_JAGFPW0.. - Region 1 - sactipeptide

Download region GenBank file

Download region SVG

Location: 15,275 - 36,886 nt. (total: 21,612 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Sactipeptides

Similar known gene clusters

Sactipeptide predictions

Putative Sactipeptide(s)

ctg24_21 leader / core peptide: MKKAVIVENK - GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sactipeptides

Core peptide predictions

ctg24_21: Putative sactipeptide; RODEO score: 33.0; Core sequence, approximate: GCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

c00031_JAGFPW0.. - Region 1 - PKS-like,T1PKS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 32,245 nt. (total: 32,245 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 32245:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 30052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 0 - 21962:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg31_6

PKS_AT (592..871): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 25.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00034_JAGFPW0.. - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 83,786 - 111,663 nt. (total: 27,878 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg34_103 - Putative Class II

ctg34_101 leader / core peptide: MKTEFSKLQKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbVDhaKECMAWC
ctg34_102 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPALDhaVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC

Lanthipeptide(s) for ctg34_105 - Putative Class II

ctg34_101 leader / core peptide: MKTEFSKLQKEVKQEQVTWFEEVVDQEFDDDVFGA - CDhbDhbNDhbFDhaLDhaDYWGNKGGWCDhbVDhaKECMAWC
ctg34_102 leader / core peptide: MNDKKSIANNSLKNELELGKYLESDMIALTEDDVVGG - WDhbPALDhaVIDhbGYIDhaDhaNDhbCPDhbDhbACDhbRAC
allorf_103311_103511 leader / core peptide: MWGSEIHSLGSFLRSLIYHSKLLARSVMLFFS - FPEYLKNDhbNDhbNIIDhaKKIINCCVLKARDhbHFWAVDhaA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg34_101 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3151.3 Da

Molecular weight: 3153.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3171.6 Da N = 1; 3189.6 Da N = 2; 3207.6 Da N = 3

ctg34_102 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2554.3 Da

Molecular weight: 2555.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2573.9 Da N = 1; 2591.9 Da N = 2; 2610.0 Da N = 3; 2628.0 Da N = 4; 2646.0 Da N = 5; 2664.0 Da N = 6

ctg34_101 - Class II

Cleavage pHMM score: 2.00

RODEO score: 0

Monoisotopic mass: 3151.3 Da

Molecular weight: 3153.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3171.6 Da N = 1; 3189.6 Da N = 2; 3207.6 Da N = 3

ctg34_102 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2554.3 Da

Molecular weight: 2555.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2573.9 Da N = 1; 2591.9 Da N = 2; 2610.0 Da N = 3; 2628.0 Da N = 4; 2646.0 Da N = 5; 2664.0 Da N = 6

allorf_103311_103511 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 3832.1 Da

Molecular weight: 3834.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3852.5 Da N = 1; 3870.5 Da N = 2; 3888.6 Da N = 3

c00034_JAGFPW0.. - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 129,233 - 143,103 nt. (total: 13,871 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00046_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,207 nt. (total: 9,207 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9207:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg46_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1903): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

c00047_JAGFPW0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 7,383 nt. (total: 7,383 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7383:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00048_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,850 nt. (total: 6,850 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6850:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg48_1

Search NORINE for peptide: strict or relaxed

AMP-binding (551..941): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DpvQiGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

ctg48_3

Search NORINE for peptide: strict or relaxed

AMP-binding (12..348): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: lFWfnvyIiK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 40% (weak)

c00050_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 5,718 nt. (total: 5,718 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5718:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg50_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..330): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg50_2

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DImQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

c00052_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 4,774 nt. (total: 4,774 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

c00056_JAGFPW0.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 74,642 - 115,738 nt. (total: 41,097 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00057_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 2,047 nt. (total: 2,047 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

c00065_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 25,169 nt. (total: 25,169 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25169:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg65_2

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00067_JAGFPW0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 72,694 - 119,830 nt. (total: 47,137 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 72693 - 119830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg67_93

Search NORINE for peptide: strict or relaxed

AMP-binding (463..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg67_95

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)