GCA_017948535.1 - 20 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JAFKQM010000001 (original name was: JAFKQM010000001.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	PKS-like	64,315	105,559	butirosin A / butirosin B	Saccharide	7%
Region 1.2	terpene	187,642	208,382
Region 1.3	transAT-PKS	511,344	597,691	macrolactin H	Polyketide	100%
Region 1.4	transAT-PKS,T3PKS,NRPS	825,259	925,221	bacillaene	Polyketide + NRP	100%
Region 1.5	NRPS,transAT-PKS,betalactone	989,754	1,077,241	fengycin	NRP	80%

JAFKQM010000010 (original name was: JAFKQM010000010.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	transAT-PKS-like	1	24,359	difficidin	Polyketide + NRP	26%

JAFKQM010000013 (original name was: JAFKQM010000013.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	1	13,257	plipastatin	NRP	23%

JAFKQM010000014 (original name was: JAFKQM010000014.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	NRPS	1	9,661	fengycin	NRP	13%

JAFKQM010000002 (original name was: JAFKQM010000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	other	305,892	347,310	bacilysin	Other	100%
Region 10.2	NRPS	546,574	614,103
Region 10.3	RiPP-like,NRPS	902,364	954,158	bacillibactin	NRP	100%

JAFKQM010000003 (original name was: JAFKQM010000003.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	transAT-PKS	1	34,177	difficidin	Polyketide + NRP	46%

JAFKQM010000004 (original name was: JAFKQM010000004.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	NRPS	135,359	200,769	surfactin	NRP:Lipopeptide	82%

JAFKQM010000005 (original name was: JAFKQM010000005.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	transAT-PKS-like	1	47,023	difficidin	Polyketide + NRP	53%
Region 13.2	T3PKS	162,481	203,581
Region 13.3	terpene	269,000	290,883
Region 13.4	RiPP-like	299,052	309,876
Region 13.5	NRPS	364,675	386,408	plipastatin	NRP	30%

JAFKQM010000006 (original name was: JAFKQM010000006.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	ladderane	67,758	108,879

JAFKQM010000008 (original name was: JAFKQM010000008.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	lanthipeptide-class-ii	47,908	66,372

Compact view

c00001_JAFKQM0.. - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 64,315 - 105,559 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

c00001_JAFKQM0.. - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 187,642 - 208,382 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00001_JAFKQM0.. - Region 3 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 511,344 - 597,691 nt. (total: 86,348 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 511343 - 597691:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal)
Non-colinear ordering:: ctg1_563 + ctg1_564 + ctg1_568 + ctg1_567 + ctg1_565 + ctg1_569 + ctg1_566

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_563

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.5
inactive: 32.0
Methoxymalonyl-CoA: 28.9
Methylmalonyl-CoA: 20.9
Propionyl-CoA: 17.3
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00001_JAFKQM0.. - Region 4 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 825,259 - 925,221 nt. (total: 99,963 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 825258 - 925221:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_824

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.0
inactive: 46.8
Methoxymalonyl-CoA: 38.9
Methylmalonyl-CoA: 25.3
Propionyl-CoA: 23.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_825

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 37.3
inactive: 27.1
Methoxymalonyl-CoA: 19.8
Benzoyl-CoA: 11.5
Methylmalonyl-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_826

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.4
inactive: 28.2
Methoxymalonyl-CoA: 23.4
Methylmalonyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_831

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.7
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg1_834

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

c00001_JAFKQM0.. - Region 5 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 989,754 - 1,077,241 nt. (total: 87,488 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 5, location 989753 - 1077241:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 989753 - 1066718:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 1049631 - 1077241:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_939

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1792..2191): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_940

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3287..3694): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4336..4743): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg1_941

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 621.8
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg1_942

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.4
inactive: 30.4
Methoxymalonyl-CoA: 20.5
Propionyl-CoA: 12.0
Methylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg1_961

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg1_965

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg1_966

Search NORINE for peptide: strict or relaxed

AMP-binding (202..594): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00002_JAFKQM0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 24,359 nt. (total: 24,359 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24359:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (mal - mal) + (mal) + (ohmal - mal - mal)
Non-colinear ordering:: ctg2_1 + ctg2_2 + ctg2_4 + ctg2_3

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00005_JAFKQM0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 13,257 nt. (total: 13,257 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13257:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn) + (tyr - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_2

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg5_3

Search NORINE for peptide: strict or relaxed

AMP-binding (203..608): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00006_JAFKQM0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,661 nt. (total: 9,661 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9661:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-val) + (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_1

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg6_2

Search NORINE for peptide: strict or relaxed

AMP-binding (203..596): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

c00010_JAFKQM0.. - Region 1 - other

Download region GenBank file

Download region SVG

Location: 305,892 - 347,310 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00010_JAFKQM0.. - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 546,574 - 614,103 nt. (total: 67,530 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 546573 - 614103:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-cys - ser - cys - ala) + (X - asn - D-asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_571

Search NORINE for peptide: strict or relaxed

CAL_domain (44..474): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 110.1
Acetyl-CoA: 26.6
NH2: 24.7
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1130..1514): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLyNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2620..3019): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWqIiLVnK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (3938..4322): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLyNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (4965..5358): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DVWCIAmIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

ctg10_572

Search NORINE for peptide: strict or relaxed

AMP-binding (299..683): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DqgSeGtVnK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 50% (weak)

AMP-binding (1320..1708): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (2346..2734): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00010_JAFKQM0.. - Region 3 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 902,364 - 954,158 nt. (total: 51,795 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 902363 - 954158:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 907030 - 954158:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_908

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

ctg10_910

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00011_JAFKQM0.. - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 34,177 nt. (total: 34,177 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 34177:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_3

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg11_6

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.0
inactive: 30.6
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.3
Propionyl-CoA: 15.8
2-Methylbutyryl-CoA: 14.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

c00012_JAFKQM0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 135,359 - 200,769 nt. (total: 65,411 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 135358 - 200769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg12_150

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg12_151

Search NORINE for peptide: strict or relaxed

AMP-binding (471..865): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1503..1905): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2548..2937): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg12_152

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00013_JAFKQM0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 47,023 nt. (total: 47,023 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 47023:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - mal) + (mal - ccmal) + (mal - ohmal - mal) + (ccmal - mal)
Non-colinear ordering:: ctg13_1 + ctg13_3 + ctg13_2 + ctg13_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00013_JAFKQM0.. - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 162,481 - 203,581 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00013_JAFKQM0.. - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 269,000 - 290,883 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00013_JAFKQM0.. - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 299,052 - 309,876 nt. (total: 10,825 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00013_JAFKQM0.. - Region 5 - NRPS

Download region GenBank file

Download region SVG

Location: 364,675 - 386,408 nt. (total: 21,734 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

c00014_JAFKQM0.. - Region 1 - ladderane

Download region GenBank file

Download region SVG

Location: 67,758 - 108,879 nt. (total: 41,122 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00016_JAFKQM0.. - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 47,908 - 66,372 nt. (total: 18,465 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_74 - Putative Class II

ctg16_75 leader / core peptide: MSEKQIERTIRAWKDPEFRKTLSDVADHPSGSIEARQLSMLGS - EDNVNPMDhbDhbPVDhaPAPDhbVVIRVDhaLKVCPDhbFKIKCKV
allorf_65154_65354 leader / core peptide: LPSYMQVSAYS - FWNFPGMHRIPAVNFDhaQDRRNLAVERIVDhbFRDhbAEDhbPCFDhaQLLKRHDhbAFLDhbDhaCPLL
allorf_65128_65328 leader / core peptide: MRYDVSAAEKNRAFRLCGMLRYVLQPNYADLAKSSQREYGA - CRENDhaKDhbNRRKPACKDhbANGNVKKRDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg16_75 - Class II

Cleavage pHMM score: -3.30

RODEO score: 0

Monoisotopic mass: 3702.1 Da

Molecular weight: 3704.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3722.5 Da N = 1; 3740.5 Da N = 2; 3758.5 Da N = 3; 3776.5 Da N = 4

allorf_65154_65354 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 6287.3 Da

Molecular weight: 6291.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 6309.3 Da N = 1; 6327.3 Da N = 2; 6345.3 Da N = 3; 6363.3 Da N = 4; 6381.4 Da N = 5; 6399.4 Da N = 6

allorf_65128_65328 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 2787.5 Da

Molecular weight: 2789.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2807.2 Da N = 1; 2825.2 Da N = 2