GCA_019126415.1 - 2 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

JAHOCG010000024 (original name was: JAHOCG010000024.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,730	36,858

JAHOCG010000030 (original name was: JAHOCG010000030.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	lanthipeptide-class-i	1	16,666

Region	Type	From	To	Most similar known cluster	Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,730	36,858
Region 23.1	lanthipeptide-class-i	1	16,666

No secondary metabolite regions were found in these records:: JAHOCG010000010 (original name was: JAHOCG010000010.1); JAHOCG010000011 (original name was: JAHOCG010000011.1); JAHOCG010000012 (original name was: JAHOCG010000012.1); JAHOCG010000013 (original name was: JAHOCG010000013.1); JAHOCG010000014 (original name was: JAHOCG010000014.1); JAHOCG010000015 (original name was: JAHOCG010000015.1); JAHOCG010000016 (original name was: JAHOCG010000016.1); JAHOCG010000017 (original name was: JAHOCG010000017.1); JAHOCG010000018 (original name was: JAHOCG010000018.1); JAHOCG010000019 (original name was: JAHOCG010000019.1); JAHOCG010000001 (original name was: JAHOCG010000001.1); JAHOCG010000020 (original name was: JAHOCG010000020.1); JAHOCG010000021 (original name was: JAHOCG010000021.1); JAHOCG010000022 (original name was: JAHOCG010000022.1); JAHOCG010000023 (original name was: JAHOCG010000023.1); JAHOCG010000025 (original name was: JAHOCG010000025.1); JAHOCG010000026 (original name was: JAHOCG010000026.1); JAHOCG010000027 (original name was: JAHOCG010000027.1); JAHOCG010000028 (original name was: JAHOCG010000028.1); JAHOCG010000029 (original name was: JAHOCG010000029.1); JAHOCG010000002 (original name was: JAHOCG010000002.1); JAHOCG010000031 (original name was: JAHOCG010000031.1); JAHOCG010000032 (original name was: JAHOCG010000032.1); JAHOCG010000033 (original name was: JAHOCG010000033.1); JAHOCG010000034 (original name was: JAHOCG010000034.1); JAHOCG010000035 (original name was: JAHOCG010000035.1); JAHOCG010000036 (original name was: JAHOCG010000036.1); JAHOCG010000037 (original name was: JAHOCG010000037.1); JAHOCG010000038 (original name was: JAHOCG010000038.1); JAHOCG010000003 (original name was: JAHOCG010000003.1); JAHOCG010000039 (original name was: JAHOCG010000039.1); JAHOCG010000040 (original name was: JAHOCG010000040.1); JAHOCG010000041 (original name was: JAHOCG010000041.1); JAHOCG010000042 (original name was: JAHOCG010000042.1); JAHOCG010000043 (original name was: JAHOCG010000043.1); JAHOCG010000044 (original name was: JAHOCG010000044.1); JAHOCG010000045 (original name was: JAHOCG010000045.1); JAHOCG010000046 (original name was: JAHOCG010000046.1); JAHOCG010000047 (original name was: JAHOCG010000047.1); JAHOCG010000048 (original name was: JAHOCG010000048.1); JAHOCG010000004 (original name was: JAHOCG010000004.1); JAHOCG010000049 (original name was: JAHOCG010000049.1); JAHOCG010000050 (original name was: JAHOCG010000050.1); JAHOCG010000051 (original name was: JAHOCG010000051.1); JAHOCG010000005 (original name was: JAHOCG010000005.1); JAHOCG010000006 (original name was: JAHOCG010000006.1); JAHOCG010000007 (original name was: JAHOCG010000007.1); JAHOCG010000008 (original name was: JAHOCG010000008.1); JAHOCG010000009 (original name was: JAHOCG010000009.1)

Compact view

c00016_JAHOCG0.. - Region 1 - RRE-containing,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 16,730 - 36,858 nt. (total: 20,129 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_36 - Putative Class I

allorf_29979_30155 leader / core peptide: MNTAILEKPTVDVMDIDLDIDVEDLPVEQIDQ - IRLDhbDhaIDhaLCDhbPGCDhbDhaPNGGDhaGCDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

allorf_29979_30155 - Class I

Cleavage pHMM score: -10.80

RODEO score: 26

Monoisotopic mass: 2419.1 Da

Molecular weight: 2420.8 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2438.8 Da N = 1; 2456.8 Da N = 2; 2474.9 Da N = 3

c00023_JAHOCG0.. - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 16,666 nt. (total: 16,666 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

No core peptides found.