GCA_019458745.1 - 16 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JAIBLH010000001 (original name was: JAIBLH010000001.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS,RiPP-like	77,356	129,149	bacillibactin	NRP	100%
Region 1.2	other	652,422	693,840	bacilysin	Other	100%

JAIBLH010000002 (original name was: JAIBLH010000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	transAT-PKS	88,275	176,508	macrolactin H	Polyketide	100%
Region 2.2	terpene	491,264	512,004
Region 2.3	PKS-like	594,778	636,022	butirosin A / butirosin B	Saccharide	7%

JAIBLH010000004 (original name was: JAIBLH010000004.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	transAT-PKS,T3PKS,NRPS	133,627	233,851	bacillaene	Polyketide + NRP	100%
Region 4.2	NRPS,transAT-PKS,betalactone	303,500	440,601	fengycin	NRP	100%
Region 4.3	terpene	463,580	485,463

JAIBLH010000005 (original name was: JAIBLH010000005.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	lanthipeptide-class-ii	112,189	135,371	mersacidin	RiPP:Lanthipeptide	100%

JAIBLH010000006 (original name was: JAIBLH010000006.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	NRPS	105	58,128	surfactin	NRP:Lipopeptide	91%
Region 6.2	NRPS,transAT-PKS	136,691	214,421	rhizocticin A	Other	16%

JAIBLH010000007 (original name was: JAIBLH010000007.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	transAT-PKS-like	1	46,470	difficidin	Polyketide + NRP	53%
Region 7.2	T3PKS	162,411	203,511

JAIBLH010000009 (original name was: JAIBLH010000009.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	LAP	26,754	48,966	plantazolicin	RiPP:LAP	91%

JAIBLH010000014 (original name was: JAIBLH010000014.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	transAT-PKS	1	34,055	difficidin	Polyketide + NRP	46%

JAIBLH010000015 (original name was: JAIBLH010000015.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	transAT-PKS-like	1	23,013	difficidin	Polyketide + NRP	26%

Compact view

c00001_JAIBLH0.. - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 77,356 - 129,149 nt. (total: 51,794 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 77355 - 129149:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 77355 - 124483:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_102

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_104

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

c00001_JAIBLH0.. - Region 2 - other

Download region GenBank file

Download region SVG

Location: 652,422 - 693,840 nt. (total: 41,419 nt) Show pHMM detection rules used

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00002_JAIBLH0.. - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 88,275 - 176,508 nt. (total: 88,234 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 88274 - 176508:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ccmal - ccmal) + (ccmal - mal - ccmal) + (ohmal - mal)
Non-colinear ordering:: ctg2_105 + ctg2_111 + ctg2_107 + ctg2_109 + ctg2_110 + ctg2_108 + ctg2_106

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_111

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.9
inactive: 31.2
Methoxymalonyl-CoA: 26.1
Methylmalonyl-CoA: 19.6
Propionyl-CoA: 16.9
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00002_JAIBLH0.. - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 491,264 - 512,004 nt. (total: 20,741 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00002_JAIBLH0.. - Region 3 - PKS-like

Download region GenBank file

Download region SVG

Location: 594,778 - 636,022 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

c00004_JAIBLH0.. - Region 1 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 133,627 - 233,851 nt. (total: 100,225 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 133626 - 233851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_147

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.2
inactive: 46.7
Methoxymalonyl-CoA: 38.4
Methylmalonyl-CoA: 24.9
Propionyl-CoA: 23.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_148

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 35.4
inactive: 26.4
Methoxymalonyl-CoA: 14.9
Benzoyl-CoA: 14.0
Methylmalonyl-CoA: 9.2
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_149

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.5
inactive: 29.1
Methoxymalonyl-CoA: 23.3
Methylmalonyl-CoA: 10.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_154

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.7
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg4_157

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

c00004_JAIBLH0.. - Region 2 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 303,500 - 440,601 nt. (total: 137,102 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 303499 - 440601:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile) + (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 303499 - 380040:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 362931 - 440601:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - D-orn) + (tyr - D-thr) + (glu - D-val) + (pro - glu - D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_264

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1789..2188): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg4_265

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3287..3694): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4336..4743): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg4_266

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 624.6
NH2: 18.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg4_267

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.7
inactive: 30.0
Methoxymalonyl-CoA: 20.4
Propionyl-CoA: 11.8
Methylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_287

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg4_291

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg4_292

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1901): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGSVEK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (2532..2924): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg4_293

Search NORINE for peptide: strict or relaxed

AMP-binding (468..873): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1898): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg4_294

Search NORINE for peptide: strict or relaxed

AMP-binding (474..867): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTLTAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1509..1905): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg4_295

Search NORINE for peptide: strict or relaxed

AMP-binding (463..868): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1500..1905): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00004_JAIBLH0.. - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 463,580 - 485,463 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00005_JAIBLH0.. - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 112,189 - 135,371 nt. (total: 23,183 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg5_109 - Putative Class II

ctg5_106 leader / core peptide: MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGA - GDMEAACDhbFDhbLPGGGGVCDhbLDhbDhaECIC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

Lanthipeptides

Core peptide predictions

ctg5_106 - Class II

Cleavage pHMM score: -2.00

RODEO score: 0

Monoisotopic mass: 2399.0 Da

Molecular weight: 2400.8 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2418.8 Da N = 1

c00006_JAIBLH0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 105 - 58,128 nt. (total: 58,024 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 104 - 58128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_16

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg6_17

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2547..2936): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg6_18

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00006_JAIBLH0.. - Region 2 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 136,691 - 214,421 nt. (total: 77,731 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 136690 - 214421:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - D-phe) + (X - D-asn - gly) + (ccmal) + (D-glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_133

Search NORINE for peptide: strict or relaxed

AMP-binding (1198..1599): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDIGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg6_137

PKS_AT (6..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.1
inactive: 50.8
Methoxymalonyl-CoA: 39.3
Isobutyryl-CoA: 31.6
Methylmalonyl-CoA: 29.7
Propionyl-CoA: 12.0
CHC-CoA: 10.8
fatty_acid: 10.4
Benzoyl-CoA: 10.0
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg6_138

Search NORINE for peptide: strict or relaxed

AMP-binding (264..665): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1303..1697): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (2805..3198): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQmGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

ctg6_139

Search NORINE for peptide: strict or relaxed

AMP-binding (248..645): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1287..1678): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTIAAICK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 100% (strong)

c00007_JAIBLH0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 46,470 nt. (total: 46,470 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 46470:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - mal) + (mal - ccmal) + (mal - ohmal - mal) + (ccmal - mal)
Non-colinear ordering:: ctg7_1 + ctg7_3 + ctg7_2 + ctg7_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00007_JAIBLH0.. - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 162,411 - 203,511 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00009_JAIBLH0.. - Region 1 - LAP

Download region GenBank file

Download region SVG

Location: 26,754 - 48,966 nt. (total: 22,213 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00014_JAIBLH0.. - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 34,055 nt. (total: 34,055 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 34055:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_3

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg14_6

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 86.6
Methoxymalonyl-CoA: 24.9
inactive: 23.4
2-Methylbutyryl-CoA: 14.3
Methylmalonyl-CoA: 14.1
Propionyl-CoA: 13.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

c00015_JAIBLH0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 23,013 nt. (total: 23,013 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 23013:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - mal) + (mal) + (ccmal) + (mal - mal)
Non-colinear ordering:: ctg15_3 + ctg15_2 + ctg15_5 + ctg15_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions