GCA_020179775.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

JAIONG010000001 (original name was: JAIONG010000001.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS,RiPP-like	32,838	84,632	bacillibactin	NRP	100%
Region 1.2	lanthipeptide-class-ii	250,917	277,270

JAIONG010000002 (original name was: JAIONG010000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	transAT-PKS,T3PKS,NRPS	162,050	264,663	bacillaene	Polyketide + NRP	100%

JAIONG010000003 (original name was: JAIONG010000003.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	T3PKS	91,741	132,841
Region 3.2	terpene	212,554	234,437

JAIONG010000004 (original name was: JAIONG010000004.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	betalactone,transAT-PKS,NRPS	1	80,319	mycosubtilin	NRP + Polyketide	100%

JAIONG010000008 (original name was: JAIONG010000008.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	PKS-like	66,462	107,706	butirosin A / butirosin B	Saccharide	7%

JAIONG010000009 (original name was: JAIONG010000009.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	transAT-PKS	13,034	101,264	macrolactin H	Polyketide	100%

JAIONG010000010 (original name was: JAIONG010000010.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	RiPP-like	44,606	57,684

JAIONG010000011 (original name was: JAIONG010000011.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	other	90,742	118,379	bacilysin	Other	100%

JAIONG010000020 (original name was: JAIONG010000020.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	transAT-PKS-like	23,137	69,738	difficidin	Polyketide + NRP	53%

JAIONG010000021 (original name was: JAIONG010000021.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS	1	55,299	surfactin	NRP:Lipopeptide	82%

JAIONG010000027 (original name was: JAIONG010000027.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	transAT-PKS	1	34,356	difficidin	Polyketide + NRP	46%

JAIONG010000033 (original name was: JAIONG010000033.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	terpene	13,862	29,395

JAIONG010000036 (original name was: JAIONG010000036.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 36.1	transAT-PKS-like	1	22,998	difficidin	Polyketide + NRP	26%

JAIONG010000039 (original name was: JAIONG010000039.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	NRPS	1	18,628	plipastatin	NRP	61%

JAIONG010000040 (original name was: JAIONG010000040.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	RiPP-like	8,147	18,478

Compact view

c00001_JAIONG0.. - Region 1 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 32,838 - 84,632 nt. (total: 51,795 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 32837 - 84632:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 32837 - 79965:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_58

Search NORINE for peptide: strict or relaxed

AMP-binding (456..855): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1513..1929): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg1_60

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 100% (strong)

c00001_JAIONG0.. - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 250,917 - 277,270 nt. (total: 26,354 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_278 - Putative Class II

ctg1_279 leader / core peptide: MKKDMVKKASGFIEEDELISLANGDNATGG - ADhbPADhbVVLDhbADhbIGLDhbGDhbDhbFDhbVDhbLDhaAADhaCPDhbDhaACDhbKQCNK
ctg1_281 leader / core peptide: MKKTKILKTPELKVTKDLNLIDPCGDVLEEIKEHEVSGA - FNDhbWNDhbDhbDhbDhbDhaLGGILVDhaEVLGNKGKVCDhbGDhbKECQGDhbC
allorf_252303_252449 leader / core peptide: VLKLYTIYVFFHVIPLTMRMFLQSLPIA - RIDhaCRIIFFINCKKYDILDhaA
allorf_257945_258010 leader / core peptide: LAINFLSNSLYS - FNDhbDhaFGCRK

Lanthipeptide(s) for ctg1_280 - Putative Class II

ctg1_279 leader / core peptide: MKKDMVKKASGFIEEDELISLANGDNATGG - ADhbPADhbVVLDhbADhbIGLDhbGDhbDhbFDhbVDhbLDhaAADhaCPDhbDhaACDhbKQCNK
ctg1_281 leader / core peptide: MKKTKILKTPELKVTKDLNLIDPCGDVLEEIKEHEVSGA - FNDhbWNDhbDhbDhbDhbDhaLGGILVDhaEVLGNKGKVCDhbGDhbKECQGDhbC
allorf_257945_258010 leader / core peptide: LAINFLSNSLYS - FNDhbDhaFGCRK
allorf_257736_257876 leader / core peptide: LSLKEKCEEESVQRA - FGKDhbHWRIMPKAWVDhaIGLLDHHFPNKKGNAC
allorf_258078_258200 leader / core peptide: MRLAGVPMKEMMQKLNIKNTRTCRLGLDSIKLG - IYIRDhbAC
allorf_273844_274074 leader / core peptide: LVLSDRNAIMKADKGRGRTPFPFFHENRLSESAGL - LQNVRVLKFPRHFRFLDhaRLPWLRRRDhaAPCPEAAICPAAEADha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

ctg1_279 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 3576.9 Da

Molecular weight: 3579.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3597.1 Da N = 1; 3615.2 Da N = 2; 3633.2 Da N = 3; 3651.2 Da N = 4; 3669.2 Da N = 5; 3687.2 Da N = 6; 3705.3 Da N = 7; 3723.3 Da N = 8; 3741.3 Da N = 9; 3759.3 Da N = 10; 3777.3 Da N = 11

ctg1_281 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 3666.9 Da

Molecular weight: 3669.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3687.1 Da N = 1; 3705.2 Da N = 2; 3723.2 Da N = 3; 3741.2 Da N = 4; 3759.2 Da N = 5; 3777.2 Da N = 6; 3795.3 Da N = 7

allorf_257945_258010 - Class II

Cleavage pHMM score: -3.10

RODEO score: 0

Monoisotopic mass: 1022.5 Da

Molecular weight: 1023.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1041.2 Da N = 1

allorf_257736_257876 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 3551.9 Da

Molecular weight: 3554.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3572.2 Da N = 1

allorf_258078_258200 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 820.4 Da

Molecular weight: 821.0 Da

Number of bridges: 1

allorf_273844_274074 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 4704.6 Da

Molecular weight: 4707.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4725.5 Da N = 1

ctg1_279 - Class II

Cleavage pHMM score: -5.10

RODEO score: 0

Monoisotopic mass: 3576.9 Da

Molecular weight: 3579.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3597.1 Da N = 1; 3615.2 Da N = 2; 3633.2 Da N = 3; 3651.2 Da N = 4; 3669.2 Da N = 5; 3687.2 Da N = 6; 3705.3 Da N = 7; 3723.3 Da N = 8; 3741.3 Da N = 9; 3759.3 Da N = 10; 3777.3 Da N = 11

ctg1_281 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 3666.9 Da

Molecular weight: 3669.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3687.1 Da N = 1; 3705.2 Da N = 2; 3723.2 Da N = 3; 3741.2 Da N = 4; 3759.2 Da N = 5; 3777.2 Da N = 6; 3795.3 Da N = 7

allorf_252303_252449 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 2366.3 Da

Molecular weight: 2367.9 Da

Number of bridges: 2

allorf_257945_258010 - Class II

Cleavage pHMM score: -3.10

RODEO score: 0

Monoisotopic mass: 1022.5 Da

Molecular weight: 1023.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1041.2 Da N = 1

c00002_JAIONG0.. - Region 1 - NRPS,T3PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 162,050 - 264,663 nt. (total: 102,614 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 162049 - 264663:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - ccmal - ohmal - mal) + (mal - ccmal - mal - ohmal - mal) + (mal - ccmal - ohmal) + (X - ccmal - ccmal - ccmal) + (ccmal - mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_177

PKS_AT (4..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.0
inactive: 46.8
Methoxymalonyl-CoA: 38.9
Methylmalonyl-CoA: 25.3
Propionyl-CoA: 23.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg2_178

PKS_AT (7..293): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 36.5
inactive: 26.2
Methoxymalonyl-CoA: 14.3
Benzoyl-CoA: 13.9
Methylmalonyl-CoA: 9.2
Isobutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg2_179

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 88.0
inactive: 28.1
Methoxymalonyl-CoA: 24.5
Methylmalonyl-CoA: 12.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg2_184

Search NORINE for peptide: strict or relaxed

CAL_domain (74..476): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 26.0
NH2: 9.4
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1145..1540): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg2_187

Search NORINE for peptide: strict or relaxed

AMP-binding (492..896): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVsnmAiIYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

c00003_JAIONG0.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 91,741 - 132,841 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00003_JAIONG0.. - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 212,554 - 234,437 nt. (total: 21,884 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00004_JAIONG0.. - Region 1 - NRPS,betalactone,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 80,319 nt. (total: 80,319 nt) Show pHMM detection rules used

Region on contig edge.

betalactone: (HMGL-like and AMP-binding)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 80319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 3036 - 80319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asn) + (D-tyr - D-asn - ser - glu) + (D-ser - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_5

Search NORINE for peptide: strict or relaxed

AMP-binding (12..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gclhIAApvK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

ctg4_24

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.7
inactive: 29.9
Methoxymalonyl-CoA: 21.9
Methylmalonyl-CoA: 13.0
Propionyl-CoA: 11.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_25

Search NORINE for peptide: strict or relaxed

CAL_domain (36..478): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 621.2
NH2: 18.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (2956..3351): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg4_26

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALSVGEVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (1779..2174): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3287..3694): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4336..4743): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg4_27

Search NORINE for peptide: strict or relaxed

AMP-binding (267..674): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1789..2188): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00008_JAIONG0.. - Region 1 - PKS-like

Download region GenBank file

Download region SVG

Location: 66,462 - 107,706 nt. (total: 41,245 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

c00009_JAIONG0.. - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 13,034 - 101,264 nt. (total: 88,231 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 13033 - 101264:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ccmal - ccmal) + (mal - ohmal) + (ccmal - mal) + (ccmal - ccmal) + (ohmal - ohmal - mal) + (ccmal - ccmal - mal)
Non-colinear ordering:: ctg9_37 + ctg9_38 + ctg9_42 + ctg9_41 + ctg9_39 + ctg9_43 + ctg9_40

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg9_37

PKS_AT (4..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.0
inactive: 33.0
Methoxymalonyl-CoA: 26.0
Methylmalonyl-CoA: 19.4
Propionyl-CoA: 16.1
fatty_acid: 13.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00010_JAIONG0.. - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 44,606 - 57,684 nt. (total: 13,079 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00011_JAIONG0.. - Region 1 - other

Download region GenBank file

Download region SVG

Location: 90,742 - 118,379 nt. (total: 27,638 nt) Show pHMM detection rules used

Region on contig edge.

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00020_JAIONG0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 23,137 - 69,738 nt. (total: 46,602 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 23136 - 69738:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - mal - mal) + (ohmal - mal) + (ccmal - mal) + (mal - ccmal)
Non-colinear ordering:: ctg20_58 + ctg20_59 + ctg20_57 + ctg20_56

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00021_JAIONG0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 55,299 nt. (total: 55,299 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 55299:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu - leu - D-leu) + (val - asp - D-leu) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_14

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg21_15

Search NORINE for peptide: strict or relaxed

AMP-binding (470..864): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1904): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2547..2936): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg21_16

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1908): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMMGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00027_JAIONG0.. - Region 1 - transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 34,356 nt. (total: 34,356 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 34356:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg27_3

Search NORINE for peptide: strict or relaxed

AMP-binding (15..363): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtifK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg27_6

PKS_AT (4..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.7
inactive: 30.9
Methoxymalonyl-CoA: 29.3
Methylmalonyl-CoA: 21.7
Propionyl-CoA: 16.5
2-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

c00033_JAIONG0.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 13,862 - 29,395 nt. (total: 15,534 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00036_JAIONG0.. - Region 1 - transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 22,998 nt. (total: 22,998 nt) Show pHMM detection rules used

Region on contig edge.

transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 22998:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - mal) + (mal - mal) + (mal) + (ccmal)
Non-colinear ordering:: ctg36_2 + ctg36_3 + ctg36_1 + ctg36_4

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

c00039_JAIONG0.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 18,628 nt. (total: 18,628 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 18628:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu) + (glu) + (D-tyr) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg39_2

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFYGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg39_3

Search NORINE for peptide: strict or relaxed

AMP-binding (0..240): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DGTITAEVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg39_5

Search NORINE for peptide: strict or relaxed

AMP-binding (463..868): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWHFGGVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

c00040_JAIONG0.. - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 8,147 - 18,478 nt. (total: 10,332 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.