GCA_020538795.1 - 2 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

JAJBPC010000023 (original name was: JAJBPC010000023.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,727	38,475

JAJBPC010000028 (original name was: JAJBPC010000028.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	lanthipeptide-class-i	1	20,215

Region	Type	From	To	Most similar known cluster	Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,727	38,475
Region 21.1	lanthipeptide-class-i	1	20,215

No secondary metabolite regions were found in these records:: JAJBPC010000001 (original name was: JAJBPC010000001.1); JAJBPC010000010 (original name was: JAJBPC010000010.1); JAJBPC010000011 (original name was: JAJBPC010000011.1); JAJBPC010000012 (original name was: JAJBPC010000012.1); JAJBPC010000013 (original name was: JAJBPC010000013.1); JAJBPC010000014 (original name was: JAJBPC010000014.1); JAJBPC010000015 (original name was: JAJBPC010000015.1); JAJBPC010000016 (original name was: JAJBPC010000016.1); JAJBPC010000017 (original name was: JAJBPC010000017.1); JAJBPC010000018 (original name was: JAJBPC010000018.1); JAJBPC010000019 (original name was: JAJBPC010000019.1); JAJBPC010000002 (original name was: JAJBPC010000002.1); JAJBPC010000020 (original name was: JAJBPC010000020.1); JAJBPC010000021 (original name was: JAJBPC010000021.1); JAJBPC010000022 (original name was: JAJBPC010000022.1); JAJBPC010000024 (original name was: JAJBPC010000024.1); JAJBPC010000025 (original name was: JAJBPC010000025.1); JAJBPC010000026 (original name was: JAJBPC010000026.1); JAJBPC010000027 (original name was: JAJBPC010000027.1); JAJBPC010000029 (original name was: JAJBPC010000029.1); JAJBPC010000003 (original name was: JAJBPC010000003.1); JAJBPC010000030 (original name was: JAJBPC010000030.1); JAJBPC010000031 (original name was: JAJBPC010000031.1); JAJBPC010000032 (original name was: JAJBPC010000032.1); JAJBPC010000033 (original name was: JAJBPC010000033.1); JAJBPC010000034 (original name was: JAJBPC010000034.1); JAJBPC010000035 (original name was: JAJBPC010000035.1); JAJBPC010000036 (original name was: JAJBPC010000036.1); JAJBPC010000037 (original name was: JAJBPC010000037.1); JAJBPC010000038 (original name was: JAJBPC010000038.1); JAJBPC010000004 (original name was: JAJBPC010000004.1); JAJBPC010000039 (original name was: JAJBPC010000039.1); JAJBPC010000040 (original name was: JAJBPC010000040.1); JAJBPC010000041 (original name was: JAJBPC010000041.1); JAJBPC010000042 (original name was: JAJBPC010000042.1); JAJBPC010000043 (original name was: JAJBPC010000043.1); JAJBPC010000044 (original name was: JAJBPC010000044.1); JAJBPC010000045 (original name was: JAJBPC010000045.1); JAJBPC010000046 (original name was: JAJBPC010000046.1); JAJBPC010000047 (original name was: JAJBPC010000047.1); JAJBPC010000005 (original name was: JAJBPC010000005.1); JAJBPC010000006 (original name was: JAJBPC010000006.1); JAJBPC010000007 (original name was: JAJBPC010000007.1); JAJBPC010000008 (original name was: JAJBPC010000008.1); JAJBPC010000009 (original name was: JAJBPC010000009.1)

Compact view

c00016_JAJBPC0.. - Region 1 - RRE-containing,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 16,727 - 38,475 nt. (total: 21,749 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_34 - Putative Class I

allorf_29976_30152 leader / core peptide: MNTAILEKPTVDVMDIDLDIDVEDLPVEQIDQ - IRLDhbDhaIDhaLCDhbPGCDhbDhaPNGGDhaGCDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

allorf_29976_30152 - Class I

Cleavage pHMM score: -10.80

RODEO score: 26

Monoisotopic mass: 2419.1 Da

Molecular weight: 2420.8 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2438.8 Da N = 1; 2456.8 Da N = 2; 2474.9 Da N = 3

c00021_JAJBPC0.. - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 20,215 nt. (total: 20,215 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

No core peptides found.