GCA_020539085.1 - 2 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

JAJBPQ010000023 (original name was: JAJBPQ010000023.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,728	38,476

JAJBPQ010000028 (original name was: JAJBPQ010000028.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	lanthipeptide-class-i	1	20,215

Region	Type	From	To	Most similar known cluster	Similarity
Region 16.1	RRE-containing,lanthipeptide-class-i	16,728	38,476
Region 21.1	lanthipeptide-class-i	1	20,215

No secondary metabolite regions were found in these records:: JAJBPQ010000001 (original name was: JAJBPQ010000001.1); JAJBPQ010000010 (original name was: JAJBPQ010000010.1); JAJBPQ010000011 (original name was: JAJBPQ010000011.1); JAJBPQ010000012 (original name was: JAJBPQ010000012.1); JAJBPQ010000013 (original name was: JAJBPQ010000013.1); JAJBPQ010000014 (original name was: JAJBPQ010000014.1); JAJBPQ010000015 (original name was: JAJBPQ010000015.1); JAJBPQ010000016 (original name was: JAJBPQ010000016.1); JAJBPQ010000017 (original name was: JAJBPQ010000017.1); JAJBPQ010000018 (original name was: JAJBPQ010000018.1); JAJBPQ010000019 (original name was: JAJBPQ010000019.1); JAJBPQ010000002 (original name was: JAJBPQ010000002.1); JAJBPQ010000020 (original name was: JAJBPQ010000020.1); JAJBPQ010000021 (original name was: JAJBPQ010000021.1); JAJBPQ010000022 (original name was: JAJBPQ010000022.1); JAJBPQ010000024 (original name was: JAJBPQ010000024.1); JAJBPQ010000025 (original name was: JAJBPQ010000025.1); JAJBPQ010000026 (original name was: JAJBPQ010000026.1); JAJBPQ010000027 (original name was: JAJBPQ010000027.1); JAJBPQ010000029 (original name was: JAJBPQ010000029.1); JAJBPQ010000003 (original name was: JAJBPQ010000003.1); JAJBPQ010000030 (original name was: JAJBPQ010000030.1); JAJBPQ010000031 (original name was: JAJBPQ010000031.1); JAJBPQ010000032 (original name was: JAJBPQ010000032.1); JAJBPQ010000033 (original name was: JAJBPQ010000033.1); JAJBPQ010000034 (original name was: JAJBPQ010000034.1); JAJBPQ010000035 (original name was: JAJBPQ010000035.1); JAJBPQ010000036 (original name was: JAJBPQ010000036.1); JAJBPQ010000037 (original name was: JAJBPQ010000037.1); JAJBPQ010000038 (original name was: JAJBPQ010000038.1); JAJBPQ010000004 (original name was: JAJBPQ010000004.1); JAJBPQ010000039 (original name was: JAJBPQ010000039.1); JAJBPQ010000040 (original name was: JAJBPQ010000040.1); JAJBPQ010000041 (original name was: JAJBPQ010000041.1); JAJBPQ010000042 (original name was: JAJBPQ010000042.1); JAJBPQ010000043 (original name was: JAJBPQ010000043.1); JAJBPQ010000044 (original name was: JAJBPQ010000044.1); JAJBPQ010000045 (original name was: JAJBPQ010000045.1); JAJBPQ010000005 (original name was: JAJBPQ010000005.1); JAJBPQ010000006 (original name was: JAJBPQ010000006.1); JAJBPQ010000007 (original name was: JAJBPQ010000007.1); JAJBPQ010000008 (original name was: JAJBPQ010000008.1); JAJBPQ010000009 (original name was: JAJBPQ010000009.1)

Compact view

c00016_JAJBPQ0.. - Region 1 - RRE-containing,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 16,728 - 38,476 nt. (total: 21,749 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for ctg16_34 - Putative Class I

allorf_29977_30153 leader / core peptide: MNTAILEKPTVDVMDIDLDIDVEDLPVEQIDQ - IRLDhbDhaIDhaLCDhbPGCDhbDhaPNGGDhaGCDhaFCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

allorf_29977_30153 - Class I

Cleavage pHMM score: -10.80

RODEO score: 26

Monoisotopic mass: 2419.1 Da

Molecular weight: 2420.8 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2438.8 Da N = 1; 2456.8 Da N = 2; 2474.9 Da N = 3

c00021_JAJBPQ0.. - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 20,215 nt. (total: 20,215 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

KnownClusterBlast

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Similar known gene clusters

No matches found.

Lanthipeptides

Core peptide predictions

No core peptides found.